ANKRD54 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ANKRD54 Antibody [NBP2-49652] - Staining of human cell line HEK 293 shows localization to microtubules & midbody.

Immunohistochemistry: ANKRD54 Antibody [NBP2-49652] - Staining of human colon shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANKRD54 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ANKRD54 Antibody - BSA Free (NBP2-49652) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD54
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ANKRD54 Recombinant Protein Antigen (NBP2-49652PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ANKRD54 Antibody - BSA Free

• ankyrin repeat domain 54
• LIARankyrin repeat domain-containing protein 54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD54