ANKRD11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKRD11 Antibody [NBP2-58493] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NKEKGQCSISQELKLKSFTYEYEDSKQKSDKAILLENDLSTENKLKVLKHDRDHFKKEEKLSKMKLEEKEWLFKDEKSLKRIKDTNKDISRSFR
Specificity
Specificity of human ANKRD11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD11
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ANKRD11 Antibody

  • ANCO-1
  • ANCO1ankyrin repeat domain-containing protein 11
  • ankyrin repeat domain 11
  • Ankyrin repeat-containing cofactor 1
  • ankyrin repeat-containing protein 11
  • LZ16
  • nasopharyngeal carcinoma susceptibility protein
  • T13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD6
627-CD
Species: Hu
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25200
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, B/N
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58493
Species: Hu
Applications: ICC/IF

Publications for ANKRD11 Antibody (NBP2-58493) (0)

There are no publications for ANKRD11 Antibody (NBP2-58493).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD11 Antibody (NBP2-58493) (0)

There are no reviews for ANKRD11 Antibody (NBP2-58493). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKRD11 Antibody (NBP2-58493) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ANKRD11 Products

Bioinformatics Tool for ANKRD11 Antibody (NBP2-58493)

Discover related pathways, diseases and genes to ANKRD11 Antibody (NBP2-58493). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD11 Antibody (NBP2-58493)

Discover more about diseases related to ANKRD11 Antibody (NBP2-58493).
 

Pathways for ANKRD11 Antibody (NBP2-58493)

View related products by pathway.

PTMs for ANKRD11 Antibody (NBP2-58493)

Learn more about PTMs related to ANKRD11 Antibody (NBP2-58493).

Blogs on ANKRD11

There are no specific blogs for ANKRD11, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD11
Novus 100% Guarantee