ANKRA2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ANKRA2 Antibody [NBP2-57230] - Staining of human cell line RH-30 shows localization to nucleoplasm & plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANKRA2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ANKRA2 Recombinant Protein Antigen (NBP2-57230PEP)

Reactivity Notes

Mouse 85%, Rat 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ANKRA2 Antibody - BSA Free

• ANKRARFXANK-like protein 2
• ankyrin repeat family A protein 2
• ankyrin repeat, family A (RFXANK-like), 2

Background

ANKRA2 may facilitate endocytosis by linking megalin to components of the cytoskeleton or endocytic machinery

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRA2