ANKLE2 Antibody - Azide and BSA Free

Western Blot: ANKLE2 Antibody [NBP2-92367] - Analysis of extracts of various cell lines, using ANKLE2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunohistochemistry-Paraffin: ANKLE2 Antibody [NBP2-92367] - Immunohistochemistry of paraffin-embedded Human lung cancer using ANKLE2 Rabbit pAb (NBP2-92367) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: ANKLE2 Antibody [NBP2-92367] - Immunohistochemistry of paraffin-embedded Mouse kidney using ANKLE2 Rabbit pAb (NBP2-92367) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: ANKLE2 Antibody [NBP2-92367] - Immunohistochemistry of paraffin-embedded Rat testis using ANKLE2 Rabbit pAb (NBP2-92367) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ANKLE2 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human ANKLE2 (NP_055929.1). CRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKLE2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ANKLE2 Antibody - Azide and BSA Free

• ankyrin repeat and LEM domain containing 2
• ankyrin repeat and LEM domain-containing protein 2
• FLJ22280
• FLJ36132
• KIAA0692
• LEM domain containing 7
• LEMD7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ANKLE2