AMPK gamma 1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: AMPK gamma 1 Antibody [NBP2-57986] - Staining of human cell line PC-3 shows localization to nucleoplasm, nuclear bodies & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AMPK gamma 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AMPK gamma 1 Antibody - BSA Free (NBP2-57986) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: METVISSDSSPAVENEHPQETPESNNSVYT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKAG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AMPK gamma 1 Recombinant Protein Antigen (NBP2-57986PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AMPK gamma 1 Antibody - BSA Free

• 5'-AMP-activated protein kinase subunit gamma-1
• 5'-AMP-activated protein kinase, gamma-1 subunit
• AMPK gamma 1
• AMPK gamma-1 chain
• AMPK gamma1
• AMPK subunit gamma-1
• AMPKG
• AMPKG1
• MGC8666
• PRKAG1
• protein kinase, AMP-activated, gamma 1 non-catalytic subunit

Background

The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1), is a heterotrimeric protein comprise of alpha (63 kDa), beta (30 kDa) and gamma (38 kDa) subunits. The alpah subunit is the catalytic subunit, while beta and gamma are non-catalytic subunits (although they have been found to interact with the active subunit in liver). AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (2). AMPK is activated by AMP and can be also regulated by treatment with purified protein phosphatase in vitro (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKAG1