AMPK alpha 1 Recombinant Protein Antigen

Images

 
There are currently no images for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AMPK alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKAA1.

Source: E. coli

Amino Acid Sequence: NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKAA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58302.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AMPK alpha 1 Recombinant Protein Antigen

  • AMP -activate kinase alpha 1 subunit
  • AMP-activated protein kinase, catalytic, alpha-1,5'-AMP-activated protein kinase catalytic subunit alpha-1
  • AMPK alpha 1
  • AMPK alpha 1,5'-AMP-activated protein kinase, catalytic alpha-1 chain
  • AMPK subunit alpha-1
  • AMPK
  • AMPK1
  • AMPKa1
  • EC 2.7.11
  • EC 2.7.11.1
  • MGC33776
  • MGC57364
  • PRKAA1
  • protein kinase, AMP-activated, alpha 1 catalytic subunit

Background

The 5'-AMP-activated protein kinase (AMPK), a member of the SNF1 (sucrose non-fermentor) kinase family (1) AMPK is a heterotrimeric protein comprising alpha (63 kDa), beta (38 kDa) and gamma (38 kDa) subunits. The alpha subunit is the catalytic subunit (which requires phosphorylation to be active) (2-3). Beta and gamma are non-catalytic subunits, although they have been found to interact with the active subunit in liver. AMPK regulates fatty acid and sterol synthesis by phosphorylation of acetyl-CoA as well as cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase (4). AMPK also appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DRP300
Species: Hu
Applications: ELISA
MAB6898
Species: Hu, Mu
Applications: WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DLP00
Species: Hu
Applications: ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP2-58302PEP
Species: Hu
Applications: AC

Publications for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP) (0)

There are no publications for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP) (0)

There are no reviews for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AMPK alpha 1 Products

Research Areas for AMPK alpha 1 Recombinant Protein Antigen (NBP2-58302PEP)

Find related products by research area.

Blogs on AMPK alpha 1.

AMPK Alpha 1 and lipid metabolism of adipocytes
AMP-activated protein kinase (AMPK) is best known as a sensor of oxidative stress.  AMPK is activated by increased intracellular AMP levels, which are a result of alterations in cellular metabolism from causes such as hypoxia, changes in ATP, sene...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AMPK alpha 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAA1