Home » Amnionless/AMN » Amnionless/AMN Antibodies » Amnionless/AMN Antibody

Amnionless/AMN Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Amnionless/AMN Antibody [NBP1-91203] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Amnionless/AMN Antibody [NBP1-91203] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P, S-ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Amnionless/AMN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL
Specificity
Specificity of human Amnionless/AMN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Sandwich ELISA
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in sandwich ELISA reported in scientific literature (PMID: 29159972).
Control Peptide
Amnionless/AMN Protein (NBP1-91203PEP)
Publications
Read Publications using
NBP1-91203 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 29159972).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Amnionless/AMN Antibody

  • AMN
  • amnionless homolog (mouse)
  • Amnionless
  • PRO1028
  • protein amnionless
  • UNQ513/PRO1028
  • visceral endoderm-specific type 1 transmembrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cubilin Antibody
[Unconjugated]
AF3700
Simple Western lane view shows lysates of mouse kidney tissue, loaded at 0.2 mg/mL. A specific band was detected for Cubilin at approximately 500 kDa (as indicated) using 10 µg/mL of Sheep Anti-Human Cubilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3700) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
Cubilin was detected in immersion fixed paraffin-embedded sections of human kidney tissue using Sheep Anti-Human/Mouse/Rat Cubilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3700) at 1 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep IgG VisUCyte™ HRP Polymer Antibody (brown; Catalog # VC006) and counterstained with hematoxylin (blue). Specific staining was localized to convoluted tubules. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Western blot shows lysates of human, mouse, and rat kidney tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Cubilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3700) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Cubilin at approximately 500 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
ABCD1 Antibody
(OTI2C12)
NBP2-46476
Knockdown Validated: ABCD1 Antibody (OTI2C12) [NBP2-46476] - Western blot shows lysates of TIME human endothelial parental cell line and ABCD1 knockout (KO) TIME cell line. PVDF membrane was probed with 1:2000 of Mouse Anti-Human ABCD1 Monoclonal Antibody (Catalog # NBP2-46476) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for ABCD1 at approximately 75 kDa (as indicated) in the parental TIME cell line, but is not detectable in the knockout TIME cell line. This experiment was conducted under reducing conditions.
Western Blot: ABCD1 Antibody (OTI2C12) [NBP2-46476] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ABCD1.
Immunohistochemistry: ABCD1 Antibody (OTI2C12) [NBP2-46476] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: WB, IHC, KD
GIF Antibody
AF8060
Western blot shows lysates of human stomach tissue. PVDF membrane was probed with 2 µg/mL of Sheep Anti-Human GIF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8060) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for GIF at approx­imately 48-52 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
LRP2 Antibody
(CD7D5)
NB110-96417
Immunohistochemistry: LRP2 Antibody (CD7D5) [NB110-96417] - Representative immunofluorescence stainings of control (Tead4m-z+) and Tead4 maternal/zygotic mutant (Tead4m-z-) embryos for Krt8 and Krt18 (16 cell stage embryos) and Lrp2 and Dab2 (32 to 64 cell stage embryos; Lrp2 and Dab2 were not detected in earlier stage embryos). n indicates total number of embryos analyzed. Scale bar: 25 um. Image collected and cropped by CiteAb from the following publication (elifesciences.org/articles/22906), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: LRP2 Antibody (CD7D5) [NB110-96417] - Staining (paraffin-embedded tissue-sections fixed in formalin) of Megalin in the brush border of the proximal tubule.
Immunocytochemistry/Immunofluorescence: LRP2 Antibody (CD7D5) [NB110-96417] - Immunofluorescence staining of Megalin in the brush border of the proximal tubule.
(1 Review)
(14 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
MTRR Antibody
NBP1-57749
Western Blot: MTRR Antibody [NBP1-57749] - Antibody Titration: 1 ug/ml Positive control: Hela cell lysate.
Immunohistochemistry: MTRR Antibody [NBP1-57749] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: MTRR Antibody [NBP1-57749] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
TRAF-3 Antibody
NB100-56176
Immunohistochemistry-Paraffin: TRAF-3 Antibody - Unpurified [NB100-56176] - Analysis of formalin fixed paraffin-embedded (FFPE) human tonsil using this at 1:4000 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Staining was performed by Histowiz.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
CBL Antibody (3B12)
NBP2-37574
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mouse mAb against RAJI (1), RAW264.7 (2), K562 (3), SKBR-3 (4), 3T3-L1 (5), THP-1 (6) and PC-12 (7) cell lysate.
Immunocytochemistry/Immunofluorescence: CBL Antibody (3B12) [NBP2-37574] - Immunofluorescence analysis of Hela cells using C-CBL mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: CBL Antibody (3B12) [NBP2-37574] - Analysis of cancer tissues using C-CBL mouse mAb with DAB staining.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
PACAP/ADCYAP1
Antibody [Unconjugate
AF6380
Western blot shows lysates of mouse kidney tissue. PVDF Membrane was probed with 1 µg/mL of Human PACAP/ADCYAP1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6380) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PACAP/ADCYAP1 at approximately 17 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2
Species: Mu
Applications: WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Staining of paraffin embedded Human Pituitary Gland. Antibody at 2 ug/mL. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(10 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(37 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Choline
Acetyltransferase/ChA
NBP1-30052
Western Blot: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Rat brain lysate showing specific immunolabeling of the ~70k ChAT.
Immunocytochemistry/Immunofluorescence: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Representative images of lumbar spinal cord sections at 130 days immunostained with Choline Acetyltransferase/ChAT. Scale bar, 200 um. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201808888), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Rat brainstem showing specific labeling using the anti-ChAT antibody. Image courtesy of Dr. Robert Sloviter, University of Arizona.
(15 Publications)
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt

Acetylcholinesterase/A
NB100-1519
Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Staining of HepG2 (A) and Daudi cell lysates with antibody at 1 ug/mL (B) and HeLa (C) and Jurkat (D) cell lysates with antibody at 0.3 ug/mL (35 ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL), showing cytoplasmic and nuclear/Vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (4 ug/mL).
Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
MTHFR Antibody
(5D3)
NBP2-37607
Western Blot: MTHFR Antibody (5D3) [NBP2-37607] - Western blot analysis using MTHFR mouse mAb against Rat Heart cell lysate.
Immunohistochemistry-Paraffin: MTHFR Antibody (5D3) [NBP2-37607] - Analysis of intima cancer tissues (left) and prostate tissues (right) using MTHFR mouse mAb with DAB staining.
Western Blot: MTHFR Antibody (5D3) [NBP2-37607] - Western blot analysis using MTHFR mAb against HEK293 (1) and MTHFR(AA: 339-499)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Metallothionein-3
Antibody
NBP1-89772
Immunocytochemistry/Immunofluorescence: Metallothionein-3 Antibody [NBP1-89772] - Expression in mouse primary bone marrow derived macrophages. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Metallothionein-3 Antibody [NBP1-89772] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Metallothionein-3 Antibody [NBP1-89772] - Analysis in human cerebral cortex and pancreas tissues. Corresponding Metallothionein-3 RNA-seq data are presented for the same tissues.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Neprilysin-2/MMEL1
Antibody
AF2340
Neprilysin-2/MMEL1 Antibody
(1 Review)
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
ABCD2 Antibody
NBP2-92633
Immunocytochemistry/Immunofluorescence: ABCD2 Antibody [NBP2-92633] - Analysis of L929 cells using ABCD2. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: ABCD2 Antibody [NBP2-92633] - Analysis of U-2 OS cells using ABCD2. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MTR Antibody
NB100-791
Western Blot: MTR Antibody [NB100-791] - Cgl null mice exhibit female-specific alteration of enzymes involved in the remethylation of methionine. Western blotting analysis of hepatic BHMT, MTHFR and MTR protein expression levels in male and female WT and Cgl null mice. Values shown represent the mean+-s.d., *Pless than 0.05, **Pless than 0.01, ***Pless than 0.001. Image collected and cropped by CiteAb from the following publication (//bio.biologists.org/cgi/doi/10.1242/bio.013433) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: MTR Antibody [NB100-791] - Human adrenal gland. Antibody at 3.8 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Proapoptotic
Caspase Adaptor Prote ...
NBP1-92287
Western Blot: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Analysis using Anti-MZB1 antibody NBP1-92287 (A) shows similar pattern to independent antibody NBP2-55874 (B).
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human liver, lymph node, placenta and small intestine using Anti-MZB1 antibody NBP1-92287 (A) shows similar protein distribution across tissues to independent antibody NBP2-55874 (B).
Species: Hu
Applications: WB, IHC, IHC-P
Apolipoprotein
A-I/ApoA1 Antibody
NBP2-52979
Western Blot: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - Total protein from HepG2 and Hek293 cells was separated on a 4-15% gradient gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-APOA1 in 1% milk, and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-APOA1 at a 1:200 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Apolipoprotein A-I/ApoA1 Antibody [NBP2-52979] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse liver using APOA1 antibody at 1:400 dilution. The antibody generated a weak/mild cytoplasmic signal in hepatocytes with a very strong positivity near the hepatocyte membranes as well as in the inter-cellular spaces.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Amnionless/AMN Antibody (NBP1-91203)(2)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: S-ELISA.


Filter By Application
S-ELISA
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for Amnionless/AMN Antibody (NBP1-91203) (0)

There are no reviews for Amnionless/AMN Antibody (NBP1-91203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Amnionless/AMN Antibody (NBP1-91203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Amnionless/AMN Products

Bioinformatics Tool for Amnionless/AMN Antibody (NBP1-91203)

Discover related pathways, diseases and genes to Amnionless/AMN Antibody (NBP1-91203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amnionless/AMN Antibody (NBP1-91203)

Discover more about diseases related to Amnionless/AMN Antibody (NBP1-91203).
 

Pathways for Amnionless/AMN Antibody (NBP1-91203)

View related products by pathway.

PTMs for Amnionless/AMN Antibody (NBP1-91203)

Learn more about PTMs related to Amnionless/AMN Antibody (NBP1-91203).

Blogs on Amnionless/AMN

There are no specific blogs for Amnionless/AMN, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Amnionless/AMN Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AMN
Entrez
Uniprot