Amnionless/AMN Antibody

Images

 
Immunohistochemistry-Paraffin: Amnionless/AMN Antibody [NBP1-91203] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P, S-ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Amnionless/AMN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL
Specificity
Specificity of human Amnionless/AMN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Sandwich ELISA
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in sandwich ELISA reported in scientific literature (PMID: 29159972).
Control Peptide
Amnionless/AMN Protein (NBP1-91203PEP)
Publications
Read Publications using
NBP1-91203 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 29159972).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Amnionless/AMN Antibody

  • AMN
  • amnionless homolog (mouse)
  • Amnionless
  • PRO1028
  • protein amnionless
  • UNQ513/PRO1028
  • visceral endoderm-specific type 1 transmembrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-46476
Species: Hu
Applications: WB, IHC, KD
AF8060
Species: Hu
Applications: WB
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF6380
Species: Mu
Applications: WB
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-89772
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-92633
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-92287
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Amnionless/AMN Antibody (NBP1-91203)(2)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: S-ELISA.


Filter By Application
S-ELISA
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for Amnionless/AMN Antibody (NBP1-91203) (0)

There are no reviews for Amnionless/AMN Antibody (NBP1-91203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Amnionless/AMN Antibody (NBP1-91203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Amnionless/AMN Products

Bioinformatics Tool for Amnionless/AMN Antibody (NBP1-91203)

Discover related pathways, diseases and genes to Amnionless/AMN Antibody (NBP1-91203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amnionless/AMN Antibody (NBP1-91203)

Discover more about diseases related to Amnionless/AMN Antibody (NBP1-91203).
 

Pathways for Amnionless/AMN Antibody (NBP1-91203)

View related products by pathway.

PTMs for Amnionless/AMN Antibody (NBP1-91203)

Learn more about PTMs related to Amnionless/AMN Antibody (NBP1-91203).

Blogs on Amnionless/AMN

There are no specific blogs for Amnionless/AMN, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Amnionless/AMN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMN
Entrez
Uniprot