Aminopeptidase B/RNPEP Antibody

Images

 
Immunohistochemistry-Paraffin: Aminopeptidase B/RNPEP Antibody [NBP2-56918] - Immunohistochemical staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aminopeptidase B/RNPEP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPK
Specificity
Specificity of human Aminopeptidase B/RNPEP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNPEP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Aminopeptidase B/RNPEP Recombinant Protein Antigen (NBP2-56918PEP)

Reactivity Notes

Mouse 84%, Rat 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Aminopeptidase B/RNPEP Antibody

  • Aminopeptidase B
  • APB
  • AP-B
  • Arginine aminopeptidase
  • arginyl aminopeptidase (aminopeptidase B)
  • Arginyl Aminopeptidase
  • DKFZp547H084
  • EC 3.4.11
  • EC 3.4.11.6
  • RNPEP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64843
Species: Mu
Applications: Flow, IHC, IHC-Fr, IHC-P
NBP1-43281
Species: Mu
Applications: Flow, IHC, IHC-P, IP
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6386
Species: Hu
Applications: WB, IP
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003757-Q01
Species: Hu
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56918
Species: Hu
Applications: IHC, IHC-P

Publications for Aminopeptidase B/RNPEP Antibody (NBP2-56918) (0)

There are no publications for Aminopeptidase B/RNPEP Antibody (NBP2-56918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase B/RNPEP Antibody (NBP2-56918) (0)

There are no reviews for Aminopeptidase B/RNPEP Antibody (NBP2-56918). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aminopeptidase B/RNPEP Antibody (NBP2-56918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Aminopeptidase B/RNPEP Antibody (NBP2-56918)

Discover related pathways, diseases and genes to Aminopeptidase B/RNPEP Antibody (NBP2-56918). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminopeptidase B/RNPEP Antibody (NBP2-56918)

Discover more about diseases related to Aminopeptidase B/RNPEP Antibody (NBP2-56918).

Blogs on Aminopeptidase B/RNPEP

There are no specific blogs for Aminopeptidase B/RNPEP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aminopeptidase B/RNPEP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNPEP