Aminoacylase/ACY1 Antibody

Images

 
Western Blot: Aminoacylase 1 Antibody [NBP2-14261] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Aminoacylase 1 Antibody [NBP2-14261] - Staining of human kidney shows strong cytoplasmic positivity in cells in renal tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aminoacylase/ACY1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTG RPGHASRFMEDTAAEKLHKVVNSILAFRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACY1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Aminoacylase/ACY1 Protein (NBP2-14261PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aminoacylase/ACY1 Antibody

  • ACY1
  • ACY-1
  • ACY1D
  • acylase
  • aminoacylase 1
  • Aminoacylase
  • aminoacylase-1
  • EC 3.5.1
  • EC 3.5.1.14
  • N-acyl-L-amino-acid amidohydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85332
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14261
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for Aminoacylase/ACY1 Antibody (NBP2-14261) (0)

There are no publications for Aminoacylase/ACY1 Antibody (NBP2-14261).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminoacylase/ACY1 Antibody (NBP2-14261) (0)

There are no reviews for Aminoacylase/ACY1 Antibody (NBP2-14261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aminoacylase/ACY1 Antibody (NBP2-14261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aminoacylase/ACY1 Products

Bioinformatics Tool for Aminoacylase/ACY1 Antibody (NBP2-14261)

Discover related pathways, diseases and genes to Aminoacylase/ACY1 Antibody (NBP2-14261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminoacylase/ACY1 Antibody (NBP2-14261)

Discover more about diseases related to Aminoacylase/ACY1 Antibody (NBP2-14261).
 

Pathways for Aminoacylase/ACY1 Antibody (NBP2-14261)

View related products by pathway.

PTMs for Aminoacylase/ACY1 Antibody (NBP2-14261)

Learn more about PTMs related to Aminoacylase/ACY1 Antibody (NBP2-14261).

Blogs on Aminoacylase/ACY1

There are no specific blogs for Aminoacylase/ACY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aminoacylase/ACY1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACY1
Entrez
Uniprot