AMIGO2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AMIGO2 Antibody [NBP2-56648] - Staining of human cell line A549 shows localization to cytosol & the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMIGO2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEAVIAEGILKST
Specificity
Specificity of human AMIGO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMIGO2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AMIGO2 Recombinant Protein Antigen (NBP2-56648PEP)

Reactivity Notes

Mouse 86%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AMIGO2 Antibody

  • adhesion molecule with Ig-like domain 2
  • ALI1amphoterin induced gene 2
  • alivin 1
  • Alivin-1
  • AMIGO2
  • AMIGO-2
  • DEGAamphoterin-induced protein 2
  • differentially expressed in gastric adenocarcinoma
  • Differentially expressed in gastric adenocarcinomas
  • transmembrane protein AMIGO2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-81780
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP1-59941
Species: Hu
Applications: WB, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB2375
Species: Mu
Applications: WB, IHC
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02056
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-45511
Species: Hu
Applications: WB, IHC
H00004882-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
H00010160-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87447
Species: Hu
Applications: WB, ICC/IF
NBL1-08307
Species: Hu
NB100-87003
Species: Hu
Applications: WB, IP
NBP2-56648
Species: Hu
Applications: ICC/IF

Publications for AMIGO2 Antibody (NBP2-56648) (0)

There are no publications for AMIGO2 Antibody (NBP2-56648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMIGO2 Antibody (NBP2-56648) (0)

There are no reviews for AMIGO2 Antibody (NBP2-56648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AMIGO2 Antibody (NBP2-56648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AMIGO2 Products

Bioinformatics Tool for AMIGO2 Antibody (NBP2-56648)

Discover related pathways, diseases and genes to AMIGO2 Antibody (NBP2-56648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMIGO2 Antibody (NBP2-56648)

Discover more about diseases related to AMIGO2 Antibody (NBP2-56648).
 

Pathways for AMIGO2 Antibody (NBP2-56648)

View related products by pathway.

Research Areas for AMIGO2 Antibody (NBP2-56648)

Find related products by research area.

Blogs on AMIGO2

There are no specific blogs for AMIGO2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMIGO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMIGO2