AMID Antibody - BSA Free

Western Blot: AMID Antibody [NBP1-90176] - Analysis in control (vector only transfected HEK293T lysate) and AIFM2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: AMID Antibody [NBP1-90176] - Staining of human spleen shows strong granular cytoplasmic positivity in cells in red pulp.

Immunohistochemistry-Paraffin: AMID Antibody [NBP1-90176] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Immunohistochemistry-Paraffin: AMID Antibody [NBP1-90176] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: AMID Antibody [NBP1-90176] - Staining of human small intestine shows weak cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: AMID Antibody [NBP1-90176] - Staining of human testis shows weak cytoplasmic and nuclear positivity in a subset of cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AMID Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AIFM2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  AMID Protein (NBP1-90176PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AMID Antibody - BSA Free

• AMID
• apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death
• apoptosis-inducing factor 2
• Apoptosis-inducing factor homologous mitochondrion-associated inducer of death
• apoptosis-inducing factor, mitochondrion-associated, 2
• Apoptosis-inducing factor-like mitochondrion-associated inducer of death
• DKFZp686L1298
• FLJ14497
• p53-responsive gene 3 protein
• PRG3apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer ofdeath
• RP11-367H5.2

Background

AMID is encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AIFM2
• Entrez:
  • 84883(Human)
• Uniprot:
  • Q9BRQ8(Human)