AMID Antibody

Images

 
Western Blot: AMID Antibody [NBP1-90176] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: AMID Antibody [NBP1-90176] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMID Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AIFM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
AMID Protein (NBP1-90176PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AMID Antibody

  • AMID
  • apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death
  • apoptosis-inducing factor 2
  • Apoptosis-inducing factor homologous mitochondrion-associated inducer of death
  • apoptosis-inducing factor, mitochondrion-associated, 2
  • Apoptosis-inducing factor-like mitochondrion-associated inducer of death
  • DKFZp686L1298
  • FLJ14497
  • p53-responsive gene 3 protein
  • PRG3apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer ofdeath
  • RP11-367H5.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01696
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-22568
Species: Hu
Applications: IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56115
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB2476
Species: Hu
Applications: WB, IHC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-07463
Species: Hu
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-90176
Species: Hu
Applications: WB, IHC, IHC-P

Publications for AMID Antibody (NBP1-90176) (0)

There are no publications for AMID Antibody (NBP1-90176).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMID Antibody (NBP1-90176) (0)

There are no reviews for AMID Antibody (NBP1-90176). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMID Antibody (NBP1-90176) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMID Products

Bioinformatics Tool for AMID Antibody (NBP1-90176)

Discover related pathways, diseases and genes to AMID Antibody (NBP1-90176). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMID Antibody (NBP1-90176)

Discover more about diseases related to AMID Antibody (NBP1-90176).
 

Pathways for AMID Antibody (NBP1-90176)

View related products by pathway.

PTMs for AMID Antibody (NBP1-90176)

Learn more about PTMs related to AMID Antibody (NBP1-90176).
 

Research Areas for AMID Antibody (NBP1-90176)

Find related products by research area.

Blogs on AMID

There are no specific blogs for AMID, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMID Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AIFM2
Entrez
Uniprot