ALPK2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALPK2 Antibody [NBP1-83295] - Staining of human cell line BJ shows localization to cytosol.
Immunohistochemistry-Paraffin: ALPK2 Antibody [NBP1-83295] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALPK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEAPFTGTTTISFSNLGGVHKENASLAQHSEVKPCTCGPQHEEKQDRDGNIPDNFREDLKYEQSISEANDETMSPGVFSRHLPKDARAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALPK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALPK2 Protein (NBP1-83295PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALPK2 Antibody

  • alpha-kinase 2
  • EC 2.7.11.-
  • FLJ34875
  • FLJ43253
  • HAKalpha-protein kinase 2
  • heart alpha-kinase
  • Heart alpha-protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1360
Species: Mu
Applications: WB, IHC
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-31583
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00057538-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
AF641
Species: Mu
Applications: WB, IHC
NBP2-33469
Species: Hu
Applications: IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALPK2 Antibody (NBP1-83295) (0)

There are no publications for ALPK2 Antibody (NBP1-83295).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALPK2 Antibody (NBP1-83295) (0)

There are no reviews for ALPK2 Antibody (NBP1-83295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALPK2 Antibody (NBP1-83295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALPK2 Products

Bioinformatics Tool for ALPK2 Antibody (NBP1-83295)

Discover related pathways, diseases and genes to ALPK2 Antibody (NBP1-83295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALPK2 Antibody (NBP1-83295)

Discover more about diseases related to ALPK2 Antibody (NBP1-83295).
 

Pathways for ALPK2 Antibody (NBP1-83295)

View related products by pathway.

PTMs for ALPK2 Antibody (NBP1-83295)

Learn more about PTMs related to ALPK2 Antibody (NBP1-83295).
 

Research Areas for ALPK2 Antibody (NBP1-83295)

Find related products by research area.

Blogs on ALPK2

There are no specific blogs for ALPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALPK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALPK2
Entrez
Uniprot