alpha-N-acetylglucosaminidase/NAGLU Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-82601] - Staining of mouse nucleus ambiguus and lateral paragigantocellular nucleus shows positivity in neurons.
Immunohistochemistry-Paraffin: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-82601] - Staining shows weak cytoplasmic positivity in Purkinje cells.
Immunocytochemistry/ Immunofluorescence: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-82601] - Staining of mouse caudate putamen shows immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-82601] - Staining of mouse midbrain shows neuronal positivity in the reticular nucleus.
Immunocytochemistry/ Immunofluorescence: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-82601] - Staining of mouse motor cortex shows immunoreactivity in neuronal cell bodies and dendrites.
Immunocytochemistry/ Immunofluorescence: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-82601] - Staining of mouse thalamus shows neuronal immunoreactivity in paraventricular thalamic nucleus.
Immunohistochemistry-Paraffin: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-82601] - Staining of human testis shows strong cytoplasmic positivity in seminiferus ducts and leydig cells.
Immunohistochemistry-Paraffin: alpha-N-acetylglucosaminidase/NAGLU Antibody [NBP1-82601] - Staining of human lateral ventricle shows cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha-N-acetylglucosaminidase/NAGLU Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQGWLFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAGLU
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
alpha-N-acetylglucosaminidase/NAGLU Protein (NBP1-82601PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha-N-acetylglucosaminidase/NAGLU Antibody

  • alphaNacetylglucosaminidase
  • alpha-N-acetylglucosaminidase
  • EC 3.2.1.50
  • MPS3B
  • MPS-IIIB
  • N-acetyl-alpha-glucosaminidase
  • N-acetylglucosaminidase, alpha
  • NAG
  • NAGalpha-N-acetylglucosaminidase
  • NAGLU
  • UFHSD
  • UFHSD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF1239
Species: Mu
Applications: WB, IHC, IP
NBP2-54724
Species: Hu
Applications: WB, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601) (0)

There are no publications for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601) (0)

There are no reviews for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha-N-acetylglucosaminidase/NAGLU Products

Bioinformatics Tool for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601)

Discover related pathways, diseases and genes to alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601)

Discover more about diseases related to alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601).
 

Pathways for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601)

View related products by pathway.

PTMs for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601)

Learn more about PTMs related to alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601).
 

Research Areas for alpha-N-acetylglucosaminidase/NAGLU Antibody (NBP1-82601)

Find related products by research area.

Blogs on alpha-N-acetylglucosaminidase/NAGLU

There are no specific blogs for alpha-N-acetylglucosaminidase/NAGLU, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha-N-acetylglucosaminidase/NAGLU Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAGLU
Entrez