alpha-Defensin 1 Antibody - BSA Free

Immunohistochemistry: alpha-Defensin 1 Antibody [NBP2-46808] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alpha-Defensin 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEFA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  alpha-Defensin 1 Recombinant Protein Antigen (NBP2-46808PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for alpha-Defensin 1 Antibody - BSA Free

• alpha 2
• alphaDefensin 1
• alpha-Defensin 1
• DEF1
• DEF1DEFA1B
• DEFA1
• DEFA2
• defensin, alpha 1, myeloid-related sequence
• defensin, alpha 1HP-1
• HNP-1
• HNP-1HP1
• HP1
• MRS
• MRSMGC138393
• myeloid-related sequence
• neutrophil defensin 1

Background

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundantin the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine,respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequenceand distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8.The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likelyplays a role in phagocyte-mediated host defense. It differs from defensin, alpha 3 by only one amino acid. (providedby RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEFA1
• Entrez:
  • 1667(Human)
• Uniprot:
  • P59665()