Recombinant Human Alpha Actinin 4 Protein

Images

 
SDS-Page: Recombinant Human Alpha Actinin 4 Protein [H00000081-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Alpha Actinin 4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-110 of Human ACTN4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACTN4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Alpha Actinin 4 Protein

  • actinin alpha4 isoform
  • actinin, alpha 4
  • ACTININ-4
  • alpha-actinin-4
  • DKFZp686K23158
  • F-actin cross-linking protein
  • focal segmental glomerulosclerosis 1
  • FSGS
  • FSGS1
  • Non-muscle alpha-actinin 4

Background

ACTN4 - actinin, alpha 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3159
Species: Mu
Applications: WB, IHC
NBP1-32797
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-39100
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-48251
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01) (0)

There are no publications for Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01) (0)

There are no reviews for Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Alpha Actinin 4 Products

Bioinformatics Tool for Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01)

Discover related pathways, diseases and genes to Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01)

Discover more about diseases related to Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01).
 

Pathways for Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01)

View related products by pathway.

PTMs for Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01)

Learn more about PTMs related to Alpha Actinin 4 Partial Recombinant Protein (H00000081-Q01).

Blogs on Alpha Actinin 4

There are no specific blogs for Alpha Actinin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Alpha Actinin 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTN4