Alpha Actinin 3 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit Alpha Actinin 3 Antibody - Azide and BSA Free (NBP2-92608) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2). GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ACTN3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:100 - 1:500
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
103 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Alpha Actinin 3 Antibody - Azide and BSA Free
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu, Po, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Ca, Hu, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Alpha Actinin 3 Antibody (NBP2-92608) (0)
There are no publications for Alpha Actinin 3 Antibody (NBP2-92608).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Alpha Actinin 3 Antibody (NBP2-92608) (0)
There are no reviews for Alpha Actinin 3 Antibody (NBP2-92608).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Alpha Actinin 3 Antibody (NBP2-92608) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Alpha Actinin 3 Products
Research Areas for Alpha Actinin 3 Antibody (NBP2-92608)
Find related products by research area.
|
Blogs on Alpha Actinin 3