alpha 2-Macroglobulin-like 1/A2ML1 Antibody - BSA Free

Staining of human esophagus shows strong cytoplasmic/membranous positivity in squamous epithelial cells.

Staining of human esophagus, liver, skin and tonsil .

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alpha 2-Macroglobulin-like 1/A2ML1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MTFEDTSNFYHPNFPFSGKIRVRGHDDSFLKNHLVFLVIYGTNGTFNQTLVTDNNGLAPFTLETSGWNGTDVSLEGKFQMEDLVYNPEQVPRYYQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: A2ML1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  alpha 2-Macroglobulin-like 1/A2ML1 Protein (NBP2-32647PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for alpha 2-Macroglobulin-like 1/A2ML1 Antibody - BSA Free

• A2ML1
• alpha 2Macroglobulin like 1
• alpha 2-Macroglobulin-like 1
• alpha-2-macroglobulin-like 1
• alpha-2-macroglobulin-like protein 1
• C3 and PZP-like, alpha-2-macroglobulin domain containing 9
• CPAMD9

Background

The alpha-macroglobulin (AM) superfamily of proteins contains both complement components and protease inhibitors, including A2M (MIM 103950) and A2ML1. AM proteins display a unique trap mechanism of inhibition, by which the AM inhibitor undergoes a major conformational change upon its cleavage by a protease, thus trapping the protease and blocking it from subsequent substrate binding (Galliano et al., 2006 [PubMed 16298998]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: A2ML1