alpha 2-Macroglobulin-like 1/A2ML1 Antibody - BSA Free

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Analysis in human esophagus and liver tissues. Corresponding A2ML1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human esophagus, liver, skin and tonsil using Anti-A2ML1 antibody NBP2-32647 (A) shows similar protein distribution across tissues to independent antibody NBP1-84392 (B).

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human esophagus shows high expression.

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alpha 2-Macroglobulin-like 1/A2ML1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MTFEDTSNFYHPNFPFSGKIRVRGHDDSFLKNHLVFLVIYGTNGTFNQTLVTDNNGLAPFTLETSGWNGTDVSLEGKFQMEDLVYNPEQVPRYYQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: A2ML1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  alpha 2-Macroglobulin-like 1/A2ML1 Protein (NBP2-32647PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for alpha 2-Macroglobulin-like 1/A2ML1 Antibody - BSA Free

• A2ML1
• alpha 2Macroglobulin like 1
• alpha 2-Macroglobulin-like 1
• alpha-2-macroglobulin-like 1
• alpha-2-macroglobulin-like protein 1
• C3 and PZP-like, alpha-2-macroglobulin domain containing 9
• CPAMD9

Background

The alpha-macroglobulin (AM) superfamily of proteins contains both complement components and protease inhibitors, including A2M (MIM 103950) and A2ML1. AM proteins display a unique trap mechanism of inhibition, by which the AM inhibitor undergoes a major conformational change upon its cleavage by a protease, thus trapping the protease and blocking it from subsequent substrate binding (Galliano et al., 2006 [PubMed 16298998]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: A2ML1