alpha 1 Mannosidase 1A Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAN1A1. Source: E. coli
Amino Acid Sequence: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MAN1A1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37938. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for alpha 1 Mannosidase 1A Recombinant Protein Antigen
Background
a1,2-Mannosidase IA is a Type II transmembrane Golgi-resident enzyme that belongs to class I a1,2-Mannosidases (glycosylhydrolase family 47). a1,2-Mannosidases plays an essential role in the maturation of N-glycans to hybrid and complex oligosaccharides in mammalian cells. Class I a1,2- Mannosidases are conserved through evolution. They can be classified into three subgroups according to their enzymatic activities. The first subgroup includes yeast and human endoplasmic reticulum (ER) a1,2-Mannosidases that primarily trim Man9GlcNAc2 to Man8GlcNAc2 isomer B. The second subgroup includes mammalian Golgi a1,2-Mannosidases IA, IB, and IC that trim Man9GlcNAc2 to Man5GlcNAc2 through Man8GlcNAc2 isomer A and C. These Golgi mannosidases display different tissue- and cell-specific expression, subcellular localization, and substrate specificity. The third subgroup includes yeast and mammalian proteins that do not hydrolyze Man9GlcNAc2. Proteins from subgroup 1 and 3 have been implicated in ER quality control and in proteasomal degradation of misfolded glycoproteins. It was also suggested that Golgi mannosidases from the second subgroup may play a role in the ERAD (endoplasmic reticulum-associated degradation) of defective glycoproteins 1-5. Although a1,2-Mannosidase IA is predominantly detected in the juxtanuclear Golgi region by indirect immunofluorescence, significant cell type and speciesdependent variation in localization was reported. The pig liver enzyme has been localized to the ER and transitional vesicles between ER and Golgi, but is not found within the Golgi stacks of porcine hepatocytes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: ChHa, Hu
Applications: IP, WB
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: AC
Publications for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP) (0)
There are no publications for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP) (0)
There are no reviews for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP) (0)
Additional alpha 1 Mannosidase 1A Products
Research Areas for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP)
Find related products by research area.
|
Blogs on alpha 1 Mannosidase 1A