alpha 1 Mannosidase 1A Recombinant Protein Antigen

Images

 
There are currently no images for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

alpha 1 Mannosidase 1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAN1A1.

Source: E. coli

Amino Acid Sequence: TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAN1A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37938.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for alpha 1 Mannosidase 1A Recombinant Protein Antigen

  • Alpha-1,2-mannosidase IA
  • EC 3.2.1
  • EC 3.2.1.113
  • HUMM3
  • HUMM9
  • man(9)-alpha-mannosidase
  • MAN9
  • Man9-mannosidase
  • Mannosidase alpha class 1A member 1
  • mannosidase, alpha, class 1A, member 1
  • mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
  • Processing alpha-1,2-mannosidase IA

Background

a1,2-Mannosidase IA is a Type II transmembrane Golgi-resident enzyme that belongs to class I a1,2-Mannosidases (glycosylhydrolase family 47). a1,2-Mannosidases plays an essential role in the maturation of N-glycans to hybrid and complex oligosaccharides in mammalian cells. Class I a1,2- Mannosidases are conserved through evolution. They can be classified into three subgroups according to their enzymatic activities. The first subgroup includes yeast and human endoplasmic reticulum (ER) a1,2-Mannosidases that primarily trim Man9GlcNAc2 to Man8GlcNAc2 isomer B. The second subgroup includes mammalian Golgi a1,2-Mannosidases IA, IB, and IC that trim Man9GlcNAc2 to Man5GlcNAc2 through Man8GlcNAc2 isomer A and C. These Golgi mannosidases display different tissue- and cell-specific expression, subcellular localization, and substrate specificity. The third subgroup includes yeast and mammalian proteins that do not hydrolyze Man9GlcNAc2. Proteins from subgroup 1 and 3 have been implicated in ER quality control and in proteasomal degradation of misfolded glycoproteins. It was also suggested that Golgi mannosidases from the second subgroup may play a role in the ERAD (endoplasmic reticulum-associated degradation) of defective glycoproteins 1-5. Although a1,2-Mannosidase IA is predominantly detected in the juxtanuclear Golgi region by indirect immunofluorescence, significant cell type and speciesdependent variation in localization was reported. The pig liver enzyme has been localized to the ER and transitional vesicles between ER and Golgi, but is not found within the Golgi stacks of porcine hepatocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
NBP2-46439
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-93304
Species: ChHa, Hu
Applications: IP, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP1-82802
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90813
Species: Hu
Applications: IHC,  IHC-P, WB
H00008805-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, PLA, WB
NBP1-88899
Species: Hu
Applications: IHC,  IHC-P
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
MAB1904
Species: Hu
Applications: ICC, IHC, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01294
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-49174
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-83435
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87831
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-17218
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-46425
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-37938PEP
Species: Hu
Applications: AC

Publications for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP) (0)

There are no publications for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP) (0)

There are no reviews for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha 1 Mannosidase 1A Products

Research Areas for alpha 1 Mannosidase 1A Recombinant Protein Antigen (NBP2-37938PEP)

Find related products by research area.

Blogs on alpha 1 Mannosidase 1A

There are no specific blogs for alpha 1 Mannosidase 1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our alpha 1 Mannosidase 1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAN1A1