Novus Biologicals products are now on bio-techne.com

ALK-1 Antibody

Images

 
Western Blot: ALK-1 Antibody [NBP1-90254] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: ALK-1 Antibody [NBP1-90254] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALK-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACVRL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ALK-1 Protein (NBP1-90254PEP)
Publications
Read Publications using NBP1-90254.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALK-1 Antibody

  • activin A receptor type II-like 1
  • activin A receptor, type II-like kinase 1
  • Activin receptor-like kinase 1
  • ACVRL1
  • ACVRLK1ORW2
  • ALK1
  • ALK-1
  • ALK1TGF-B superfamily receptor type I
  • EC 2.7.11
  • HHT
  • HHT2EC 2.7.11.30
  • serine/threonine-protein kinase receptor R3
  • SKR3
  • TSR-I

Background

LTK, ALK and Ros have been identified as receptor tyrosine kinases having sequence similarity to the insulin receptor subfamily of kinases. LTK (leukocyte tyrosine kinase) is expressed in murine B lymphocyte precursors and has also been found in forebrain neurons. ALK (anaplastic lymphoma kinase) is normally highly expressed, specifically in the nervous system. A truncated form containing the catalytic domian of ALK is expressed as the result of a translocation occurring in many non-Hodgkin's lymphomas. The c-Ros gene was originally identified in mutant form as an oncogene. Ros is normally expressed in a small number of epithelial cell types and may play a role in epithelial development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1320
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
3209-BP/CF
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
AF4210
Species: Hu
Applications: IHC, Simple Western, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP2-46157
Species: Hu
Applications: Flow, IHC, IHC-P, WB
AF811
Species: Hu
Applications: CyTOF-ready, Flow, IHC
AF2097
Species: Hu
Applications: ChIP, ICC, WB
7754-BH/CF
Species: Hu
Applications: BA
AF637
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB

Publications for ALK-1 Antibody (NBP1-90254)(3)

Reviews for ALK-1 Antibody (NBP1-90254) (0)

There are no reviews for ALK-1 Antibody (NBP1-90254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALK-1 Antibody (NBP1-90254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALK-1 Products

Research Areas for ALK-1 Antibody (NBP1-90254)

Find related products by research area.

Blogs on ALK-1

There are no specific blogs for ALK-1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALK-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVRL1