Alix Antibody - BSA Free

Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Analysis in human cell line RT-4 and human cell line U-251 MG.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Alix Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Alix using the following amino acid sequence: GVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLR
• Predicted Species: Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDCD6IP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Alix Antibody - BSA Free

• AIP1DRIP4
• ALG-2 interacting protein 1
• ALG-2 interacting protein X
• ALG-2-interacting protein 1
• alinx
• Alix
• apoptosis-linked gene 2-interacting protein X
• dopamine receptor interacting protein 4
• HP95
• KIAA1375
• MGC17003
• PDCD6-interacting protein
• programmed cell death 6 interacting protein
• programmed cell death 6-interacting protein

Background

Alix encodes a protein thought to participate in programmed cell death. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization which may be partly responsible for the protection against cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDCD6IP