Aldo-keto Reductase 1B10/AKR1B10 Antibody


Orthogonal Strategies: Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Analysis in human cell lines A-549 and HEK293 using anti-AKR1B10 antibody. Corresponding AKR1B10 RNA-seq data are more
Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Staining of human small intestine shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-28
Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-89161] - Staining of human adrenal gland shows distinct cytoplasmic and nuclear positivity in cortical cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Aldo-keto Reductase 1B10/AKR1B10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT
Specificity of human Aldo-keto Reductase 1B10/AKR1B10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aldo-keto Reductase 1B10/AKR1B10 Protein (NBP1-89161PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Aldo-keto Reductase 1B10/AKR1B10 Antibody

  • AKR1B10
  • AKR1B11
  • AKR1B12
  • Aldo-keto Reductase 1B10
  • aldo-keto reductase family 1 member B10
  • aldo-keto reductase family 1, member B10 (aldose reductase)
  • aldo-keto reductase family 1, member B11 (aldose reductase-like)
  • AldoketoReductase 1B10
  • aldose reductase-like 1
  • aldose reductase-like peptide
  • Aldose reductase-like
  • Aldose reductase-related protein
  • ALDRLn
  • ARL1
  • ARL-1SI reductase
  • ARP
  • EC 1.1.1
  • EC 1.1.1.-
  • EC
  • hARP
  • HIS
  • HSI
  • MGC14103
  • Small intestine reductase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161) (0)

There are no publications for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161) (0)

There are no reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Aldo-keto Reductase 1B10/AKR1B10 Products

Bioinformatics Tool for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161)

Discover related pathways, diseases and genes to Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161)

Discover more about diseases related to Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161).

Pathways for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161)

View related products by pathway.

PTMs for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161)

Learn more about PTMs related to Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161).

Research Areas for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-89161)

Find related products by research area.

Blogs on Aldo-keto Reductase 1B10/AKR1B10

There are no specific blogs for Aldo-keto Reductase 1B10/AKR1B10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Aldo-keto Reductase 1B10/AKR1B10 Antibody and receive a gift card or discount.


Gene Symbol AKR1B10