ALDH3B1 Antibody

Images

 
Immunohistochemistry: ALDH3B1 Antibody [NBP2-32638] - Staining of human kidney shows strong membranous positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALDH3B1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH3B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALDH3B1 Protein (NBP2-32638PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALDH3B1 Antibody

  • aldehyde dehydrogenase 3 family, member B1
  • aldehyde dehydrogenase 3B1
  • Aldehyde dehydrogenase 7
  • aldehyde dehydrogenase family 3 member B1
  • ALDH4
  • ALDH7FLJ34710
  • EC 1.2.1
  • EC 1.2.1.5
  • FLJ26433

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02483
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89148
Species: Hu
Applications: IHC, IHC-P
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-15339
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01017
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86996
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
H00008659-D01P
Species: Hu, Mu
Applications: WB
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-1073
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NB100-485
Species: Hu
Applications: WB, IP
MAB3949
Species: Hu
Applications: Flow, CyTOF-ready
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-32638
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ALDH3B1 Antibody (NBP2-32638) (0)

There are no publications for ALDH3B1 Antibody (NBP2-32638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH3B1 Antibody (NBP2-32638) (0)

There are no reviews for ALDH3B1 Antibody (NBP2-32638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALDH3B1 Antibody (NBP2-32638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALDH3B1 Products

Bioinformatics Tool for ALDH3B1 Antibody (NBP2-32638)

Discover related pathways, diseases and genes to ALDH3B1 Antibody (NBP2-32638). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH3B1 Antibody (NBP2-32638)

Discover more about diseases related to ALDH3B1 Antibody (NBP2-32638).
 

Pathways for ALDH3B1 Antibody (NBP2-32638)

View related products by pathway.

PTMs for ALDH3B1 Antibody (NBP2-32638)

Learn more about PTMs related to ALDH3B1 Antibody (NBP2-32638).

Blogs on ALDH3B1

There are no specific blogs for ALDH3B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH3B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH3B1