ALDH5A1 Antibody

Images

 
Western Blot: ALDH5A1 Antibody [NBP1-86996] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ALDH5A1 Antibody [NBP1-86996] - Immunofluorescent staining of human cell line CACO-2 shows localization to mitochondria.
Immunohistochemistry-Paraffin: ALDH5A1 Antibody [NBP1-86996] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
Immunocytochemistry/ Immunofluorescence: ALDH5A1 Antibody [NBP1-86996] - Staining of human cell line A-431 shows positivity in mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALDH5A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH5A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ALDH5A1 Protein (NBP1-86996PEP)
Publications
Read Publication using NBP1-86996.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24551133)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALDH5A1 Antibody

  • aldehyde dehydrogenase 5 family, member A1
  • EC 1.2.1
  • EC 1.2.1.24
  • NAD(+)-dependent succinic semialdehyde dehydrogenase
  • SSADHmitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
7954-GM/CF
Species: Hu
NBP1-32828
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF3998
Species: Hu
Applications: WB
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02483
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86996
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALDH5A1 Antibody (NBP1-86996)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for ALDH5A1 Antibody (NBP1-86996) (0)

There are no reviews for ALDH5A1 Antibody (NBP1-86996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALDH5A1 Antibody (NBP1-86996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALDH5A1 Products

Bioinformatics Tool for ALDH5A1 Antibody (NBP1-86996)

Discover related pathways, diseases and genes to ALDH5A1 Antibody (NBP1-86996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH5A1 Antibody (NBP1-86996)

Discover more about diseases related to ALDH5A1 Antibody (NBP1-86996).
 

Pathways for ALDH5A1 Antibody (NBP1-86996)

View related products by pathway.

PTMs for ALDH5A1 Antibody (NBP1-86996)

Learn more about PTMs related to ALDH5A1 Antibody (NBP1-86996).

Blogs on ALDH5A1

There are no specific blogs for ALDH5A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH5A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH5A1
Entrez
Uniprot