ALDH5A1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ALDH5A1 Antibody [NBP1-86996] - Staining of human cell line CACO-2 shows localization to mitochondria. Antibody staining is shown in green.

Analysis in human liver and placenta tissues Corresponding ALDH5A1 RNA-seq data are presented for the same tissues.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Staining of human placenta shows negative to very weak granular cytoplasmic positivity in trophoblastic cells.

Analysis in human cell line Jurkat.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ALDH5A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQV
• Predicted Species: Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALDH5A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 24551133). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ALDH5A1 Protein (NBP1-86996PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24551133)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ALDH5A1 Antibody - BSA Free

• aldehyde dehydrogenase 5 family, member A1
• EC 1.2.1
• EC 1.2.1.24
• NAD(+)-dependent succinic semialdehyde dehydrogenase
• SSADHmitochondrial

Background

ALDH5A1 belongs to the aldehyde dehydrogenase family of proteins. This gene encodes a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, is a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA). In response to the defect, physiologic fluids from patients accumulate GHB, a compound with numerous neuromodulatory properties. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ALDH5A1 Antibody (NBP1-86996)(1)

Publication using NBP1-86996

• Ippolito JE, Piwnica-Worms D. A Fluorescence-Coupled Assay for Gamma Aminobutyric Acid (GABA) Reveals Metabolic Stress-Induced Modulation of GABA Content in Neuroendocrine Cancer. PLoS One 2014-01-01 [PMID: 24551133] (WB)

Bioinformatics

• Gene Symbol: ALDH5A1
• Entrez:
  • 7915(Human)
• Uniprot:
  • P51649(Human)