ALDH3B2 Antibody

Images

 
Immunohistochemistry-Paraffin: ALDH3B2 Antibody [NBP1-89148] - Staining of human smooth muscle shows strong membranous and cytoplasmic positivity in smooth muscle cells, endothelial cells are distinctly stained.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALDH3B2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH3B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ALDH3B2 Protein (NBP1-89148PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALDH3B2 Antibody

  • acetaldehyde dehydrogenase 8
  • aldehyde dehydrogenase 3 family, member B2
  • Aldehyde dehydrogenase 8
  • ALDH8aldehyde dehydrogenase family 3 member B2
  • EC 1.2.1
  • EC 1.2.1.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000221-D01P
Species: Hu, Mu
Applications: WB
NBP2-02483
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-01017
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
H00008659-D01P
Species: Hu, Mu
Applications: WB
H00145226-D01P
Species: Hu
Applications: WB, ELISA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-86996
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89148
Species: Hu
Applications: IHC, IHC-P

Publications for ALDH3B2 Antibody (NBP1-89148) (0)

There are no publications for ALDH3B2 Antibody (NBP1-89148).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH3B2 Antibody (NBP1-89148) (0)

There are no reviews for ALDH3B2 Antibody (NBP1-89148). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ALDH3B2 Antibody (NBP1-89148) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALDH3B2 Products

Bioinformatics Tool for ALDH3B2 Antibody (NBP1-89148)

Discover related pathways, diseases and genes to ALDH3B2 Antibody (NBP1-89148). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ALDH3B2

There are no specific blogs for ALDH3B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH3B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH3B2