ALDH1L1 Antibody


Western Blot: ALDH1L1 Antibody [NBP1-89414] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP1-89414] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ALDH1L1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDF
Astrocyte Marker
Specificity of human ALDH1L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
99 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ALDH1L1 Protein (NBP1-89414PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ALDH1L1 Antibody

  • 10-formyltetrahydrofolate dehydrogenase
  • aldehyde dehydrogenase 1 family, member L1
  • aldehyde dehydrogenase family 1 member L1
  • Cytosolic 10-formyltetrahydrofolate dehydrogenase
  • DKFZp781N0997
  • EC,10-FTHFDH
  • FDH
  • formyltetrahydrofolate dehydrogenase
  • FTHFD10-fTHF


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ALDH1L1 Antibody (NBP1-89414) (0)

There are no publications for ALDH1L1 Antibody (NBP1-89414).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH1L1 Antibody (NBP1-89414) (0)

There are no reviews for ALDH1L1 Antibody (NBP1-89414). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALDH1L1 Antibody (NBP1-89414) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALDH1L1 Products

Bioinformatics Tool for ALDH1L1 Antibody (NBP1-89414)

Discover related pathways, diseases and genes to ALDH1L1 Antibody (NBP1-89414). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH1L1 Antibody (NBP1-89414)

Discover more about diseases related to ALDH1L1 Antibody (NBP1-89414).

Pathways for ALDH1L1 Antibody (NBP1-89414)

View related products by pathway.

PTMs for ALDH1L1 Antibody (NBP1-89414)

Learn more about PTMs related to ALDH1L1 Antibody (NBP1-89414).

Blogs on ALDH1L1

There are no specific blogs for ALDH1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALDH1L1 Antibody and receive a gift card or discount.


Gene Symbol ALDH1L1