Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free

Western Blot: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-55797] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-55797] - Staining of human cell line A549 shows localization to nucleoplasm, cytosol & vesicles.

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-55797] - Staining in human esophagus and colon tissues using anti-ALDH3A1 antibody. Corresponding ALDH3A1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-55797] - Staining of human colon shows low expression as expected.

Immunohistochemistry-Paraffin: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody [NBP2-55797] - Staining of human esophagus shows high expression.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALDH3A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen (NBP2-55797PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody - BSA Free

• aldehyde dehydrogenase 3 family, member A1
• Aldehyde dehydrogenase 3
• Aldehyde Dehydrogenase 3A1
• Aldehyde Dehydrogenase 3-A1
• Aldehyde dehydrogenase family 3 member A1
• aldehyde dehydrogenase isozyme 3
• aldehyde dehydrogenase type III
• ALDH3A1
• ALDH3aldehyde dehydrogenase, dimeric NADP-preferring
• ALDHIII
• EC 1.2.1
• EC 1.2.1.5
• MGC10406
• stomach aldehyde dehydrogenase

Background

Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALDH3A1