Aldehyde dehydrogenase 5 Antibody

Images

 
Western Blot: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma ...read more
Immunocytochemistry/ Immunofluorescence: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: Aldehyde dehydrogenase 5 Antibody [NBP1-90192] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes and bile duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aldehyde dehydrogenase 5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH1B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aldehyde dehydrogenase 5 Protein (NBP1-90192PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aldehyde dehydrogenase 5 Antibody

  • aldehyde dehydrogenase 1 family, member B1
  • Aldehyde dehydrogenase 5
  • Aldehyde dehydrogenase family 1 member B1
  • ALDH class 2
  • ALDH5aldehyde dehydrogenase X, mitochondrial
  • ALDHXacetaldehyde dehydrogenase 5
  • EC 1.2.1
  • EC 1.2.1.3
  • MGC2230
  • mitochondrial aldehyde dehydrogenase X

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP2-02483
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00007071-M15
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-12553
Species: Hu
NBP1-85273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000130-M01
Species: Hu
Applications: WB, ELISA
H00008659-D01P
Species: Hu, Mu
Applications: WB
NBP1-81257
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6235
Species: Hu
Applications: WB

Publications for Aldehyde dehydrogenase 5 Antibody (NBP1-90192) (0)

There are no publications for Aldehyde dehydrogenase 5 Antibody (NBP1-90192).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aldehyde dehydrogenase 5 Antibody (NBP1-90192) (0)

There are no reviews for Aldehyde dehydrogenase 5 Antibody (NBP1-90192). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aldehyde dehydrogenase 5 Antibody (NBP1-90192) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aldehyde dehydrogenase 5 Products

Bioinformatics Tool for Aldehyde dehydrogenase 5 Antibody (NBP1-90192)

Discover related pathways, diseases and genes to Aldehyde dehydrogenase 5 Antibody (NBP1-90192). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldehyde dehydrogenase 5 Antibody (NBP1-90192)

Discover more about diseases related to Aldehyde dehydrogenase 5 Antibody (NBP1-90192).
 

Pathways for Aldehyde dehydrogenase 5 Antibody (NBP1-90192)

View related products by pathway.

PTMs for Aldehyde dehydrogenase 5 Antibody (NBP1-90192)

Learn more about PTMs related to Aldehyde dehydrogenase 5 Antibody (NBP1-90192).

Blogs on Aldehyde dehydrogenase 5

There are no specific blogs for Aldehyde dehydrogenase 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldehyde dehydrogenase 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH1B1