alcohol dehydrogenase 5 Antibody - BSA Free

Western Blot: alcohol dehydrogenase 5 Antibody [NBP1-56447] - Human kidney lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

alcohol dehydrogenase 5 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ADH5 (alcohol dehydrogenase 5 (class III), chi polypeptide) The peptide sequence was selected from the middle region of ADH5)(50ug). Peptide sequence KSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADH5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for alcohol dehydrogenase 5 Antibody - BSA Free

• ADH-3
• ADHXEC 1.1.1.1
• alcohol dehydrogenase (class III), chi polypeptide
• alcohol dehydrogenase 5 (class III), chi polypeptide
• Alcohol dehydrogenase 5
• Alcohol dehydrogenase class chi chain
• alcohol dehydrogenase class-3
• Alcohol dehydrogenase class-III
• EC 1.1.1
• EC 1.1.1.-
• EC 1.1.1.284
• FALDH
• FDHGSNOR
• formaldehyde dehydrogenase
• Glutathione-dependent formaldehyde dehydrogenase
• GSH-FDH
• S-(hydroxymethyl)glutathione dehydrogenase

Background

This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADH5
• Uniprot:
  • P11766(Human)