ALAD Antibody

Images

 
Western Blot: ALAD Antibody [NBP1-89157] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89157] - Staining of human stomach shows distinct cytoplasmic positivity in glandular cells.
Western Blot: ALAD Antibody [NBP1-89157] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALAD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALAD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ALAD Protein (NBP1-89157PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALAD Antibody

  • ALADHEC 4.2.1.24
  • aminolevulinate dehydratase
  • aminolevulinate, delta-, dehydratase
  • delta-aminolevulinic acid dehydratase
  • PBGSMGC5057
  • Porphobilinogen synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-85946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-56415
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for ALAD Antibody (NBP1-89157) (0)

There are no publications for ALAD Antibody (NBP1-89157).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALAD Antibody (NBP1-89157) (0)

There are no reviews for ALAD Antibody (NBP1-89157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALAD Antibody (NBP1-89157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALAD Products

Bioinformatics Tool for ALAD Antibody (NBP1-89157)

Discover related pathways, diseases and genes to ALAD Antibody (NBP1-89157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALAD Antibody (NBP1-89157)

Discover more about diseases related to ALAD Antibody (NBP1-89157).
 

Pathways for ALAD Antibody (NBP1-89157)

View related products by pathway.

PTMs for ALAD Antibody (NBP1-89157)

Learn more about PTMs related to ALAD Antibody (NBP1-89157).

Blogs on ALAD

There are no specific blogs for ALAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALAD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALAD
Entrez
Uniprot