AKT3 Antibody

Images

 
Western Blot: AKT3 Antibody [NBP1-80900] - Analysis in human cell line SH-SY5Y.
Immunocytochemistry/ Immunofluorescence: AKT3 Antibody [NBP1-80900] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry: AKT3 Antibody [NBP1-80900] - Imaging of mouse spinal cord (DAB). This image was submitted via customer Review.
Immunohistochemistry-Paraffin: AKT3 Antibody [NBP1-80900] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKT3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AKT3 Recombinant Protein Antigen (NBP1-80900PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-80900 in the following applications:

Publications
Read Publications using NBP1-80900.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22549727)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKT3 Antibody

  • Akt3
  • Akt-3
  • EC 2.7.11
  • EC 2.7.11.1
  • PKB gamma
  • PKBGDKFZp434N0250
  • PRKBG
  • RAC-gamma
  • v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-80900
Species: Hu, Mu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AKT3 Antibody (NBP1-80900)(3)

Review for AKT3 Antibody (NBP1-80900) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-80900:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry AKT3 NBP1-80900
Enlarge
reviewed by:
Anonymous
IHC Mouse 05/31/2017
View

Summary

ApplicationImmunohistochemistry
Sample Testedmouse spinal cord
SpeciesMouse
LotC81926

Comments

CommentsHigh background

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AKT3 Antibody (NBP1-80900) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKT3 Products

Bioinformatics Tool for AKT3 Antibody (NBP1-80900)

Discover related pathways, diseases and genes to AKT3 Antibody (NBP1-80900). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKT3 Antibody (NBP1-80900)

Discover more about diseases related to AKT3 Antibody (NBP1-80900).
 

Pathways for AKT3 Antibody (NBP1-80900)

View related products by pathway.

PTMs for AKT3 Antibody (NBP1-80900)

Learn more about PTMs related to AKT3 Antibody (NBP1-80900).

Blogs on AKT3

There are no specific blogs for AKT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
05/31/2017
Application: IHC
Species: Mouse

Bioinformatics

Gene Symbol AKT3
Entrez