AKR1D1 Antibody - BSA Free

Western Blot: AKR1D1 Antibody [NBP1-74082] - RPMI-8226 Cell Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AKR1D1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to the middle region of AKR1D1 (NP_005980). Peptide Sequence: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKR1D1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AKR1D1 Antibody - BSA Free

• 3o5bred
• Aldo-keto reductase family 1 member D1,3-oxo-5-beta-steroid 4-dehydrogenase
• aldo-keto reductase family 1, member D1 (delta4-3-ketosteroid-5-beta-reductase)
• CBAS2
• Delta(4)-3-oxosteroid 5-beta-reductase
• EC 1.3.1.3
• SRD5B1beta polypeptide 1 (3-oxo-5 beta-steroid delta4-dehydrogenase beta 1)

Background

The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKR1D1
• Entrez:
  • 6718(Human)
• Uniprot:
  • P51857(Human)