AKAP4 Antibody

Images

 
Immunohistochemistry: AKAP4 Antibody [NBP1-89164] - Staining of human testis shows distinct positivity in developing sperm cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKAP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EIIVIKDTEKKDQSKTEGSVCLFKQAPSDPVSVLNWLLSDLQKYALGFQHALSPSTSTCKHKVGDTEGEYHRASSENCYSVYADQVNIDYLMNRPQNLRLEMTAAKNTNNNQSPSAPPAKPPSTQRAVISPDGECSIDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AKAP4 Protein (NBP1-89164PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKAP4 Antibody

  • A kinase (PRKA) anchor protein 4
  • AKAP-4
  • AKAP82AKAP 82
  • A-kinase anchor protein 4
  • A-kinase anchor protein 82 kDa
  • cancer/testis antigen 99
  • CT99
  • hAKAP82Fsc1
  • HIFSC1
  • Major sperm fibrous sheath protein
  • p82
  • PRKA4
  • protein kinase A anchoring protein 4
  • Protein kinase A-anchoring protein 4
  • testis-specific gene HI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89164
Species: Hu
Applications: IHC, IHC-P

Publications for AKAP4 Antibody (NBP1-89164) (0)

There are no publications for AKAP4 Antibody (NBP1-89164).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP4 Antibody (NBP1-89164) (0)

There are no reviews for AKAP4 Antibody (NBP1-89164). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AKAP4 Antibody (NBP1-89164) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKAP4 Products

Bioinformatics Tool for AKAP4 Antibody (NBP1-89164)

Discover related pathways, diseases and genes to AKAP4 Antibody (NBP1-89164). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP4 Antibody (NBP1-89164)

Discover more about diseases related to AKAP4 Antibody (NBP1-89164).
 

Pathways for AKAP4 Antibody (NBP1-89164)

View related products by pathway.

PTMs for AKAP4 Antibody (NBP1-89164)

Learn more about PTMs related to AKAP4 Antibody (NBP1-89164).

Blogs on AKAP4

There are no specific blogs for AKAP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP4
Entrez
Uniprot