AIMP2 Antibody

Images

 
Western Blot: AIMP2 Antibody [NBP2-86968] - Host: Rabbit. Target Name: AIMP2. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AIMP2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AIMP2. Peptide sequence: SLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
AIMP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AIMP2 Antibody

  • aminoacyl tRNA synthase complex-interacting multifunctional protein 2
  • aminoacyl tRNA synthetase complex-interacting multifunctional protein 2
  • ARS-interacting multi-functional protein 2
  • JTV1JTV-1
  • Multisynthase complex auxiliary component p38
  • multisynthetase complex auxiliary component p38
  • P38
  • PRO0992
  • Protein JTV-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
D6050
Species: Hu
Applications: ELISA
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-86968
Species: Hu
Applications: WB

Publications for AIMP2 Antibody (NBP2-86968) (0)

There are no publications for AIMP2 Antibody (NBP2-86968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIMP2 Antibody (NBP2-86968) (0)

There are no reviews for AIMP2 Antibody (NBP2-86968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AIMP2 Antibody (NBP2-86968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AIMP2 Products

Bioinformatics Tool for AIMP2 Antibody (NBP2-86968)

Discover related pathways, diseases and genes to AIMP2 Antibody (NBP2-86968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIMP2 Antibody (NBP2-86968)

Discover more about diseases related to AIMP2 Antibody (NBP2-86968).
 

Pathways for AIMP2 Antibody (NBP2-86968)

View related products by pathway.

PTMs for AIMP2 Antibody (NBP2-86968)

Learn more about PTMs related to AIMP2 Antibody (NBP2-86968).
 

Research Areas for AIMP2 Antibody (NBP2-86968)

Find related products by research area.

Blogs on AIMP2

There are no specific blogs for AIMP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AIMP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AIMP2