AICL/CLEC-2B Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human AICL (NP_005118.2). IGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CLEC2B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
17 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for AICL/CLEC-2B Antibody - Azide and BSA Free
Background
AICL, also known as CLEC2B, is a member of the C-type lectin/C-type lectin-like domain superfamily that shares a common protein fold. The superfamily has a variety of functions including cell adhesion, glycoprotein turnover and cell-cell signaling. Disease research is currently being studied with relation to AICL and hepatitis, botulism, methylmalonic aciduria and sarcoma. This protein is known to have interactions with NINL.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
Species: Hu
Applications: WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Rt
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for AICL/CLEC-2B Antibody (NBP2-92358) (0)
There are no publications for AICL/CLEC-2B Antibody (NBP2-92358).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AICL/CLEC-2B Antibody (NBP2-92358) (0)
There are no reviews for AICL/CLEC-2B Antibody (NBP2-92358).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AICL/CLEC-2B Antibody (NBP2-92358) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AICL/CLEC-2B Products
Research Areas for AICL/CLEC-2B Antibody (NBP2-92358)
Find related products by research area.
|
Blogs on AICL/CLEC-2B