AICL/CLEC-2B Antibody - Azide and BSA Free

Western Blot: AICL Antibody [NBP2-92358] - Western blot analysis of extracts of Rat spleen, using AICL antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AICL/CLEC-2B Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit AICL/CLEC-2B Antibody - Azide and BSA Free (NBP2-92358) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human AICL (NP_005118.2). IGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for AICL/CLEC-2B Antibody - Azide and BSA Free

• Activation-induced C-type lectin
• AICL
• AICLC-type lectin superfamily member 2
• CLEC2B
• CLEC-2B
• CLECSF2
• CLECSF2IFN-alpha-2b-inducing-related protein 1
• C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 2 (activation-induced)
• C-type lectin domain family 2 member B
• C-type lectin domain family 2, member B
• HP10085
• IFN-alpha2b-inducing related protein 1
• IFNRG1

Background

AICL, also known as CLEC2B, is a member of the C-type lectin/C-type lectin-like domain superfamily that shares a common protein fold. The superfamily has a variety of functions including cell adhesion, glycoprotein turnover and cell-cell signaling. Disease research is currently being studied with relation to AICL and hepatitis, botulism, methylmalonic aciduria and sarcoma. This protein is known to have interactions with NINL.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: CLEC2B