AGXT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: AGXT2 Antibody [NBP1-89199] - Staining in human kidney and lymph node tissues using anti-AGXT2 antibody. Corresponding AGXT2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AGXT2 Antibody [NBP1-89199] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: AGXT2 Antibody [NBP1-89199] - Staining of human lymph node shows low expression as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AGXT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AGXT2 Antibody - BSA Free (NBP1-89199) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-AGXT2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGXT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, WB reactvity reported in (PMID: 24586340).
• Control Peptide:

  AGXT2 Protein (NBP1-89199PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%). Reactivity reported in scientific literature (PMID: 24586340).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AGXT2 Antibody - BSA Free

• (R)-3-amino-2-methylpropionate--pyruvate transaminase
• AGT 2
• alanine-glyoxylate aminotransferase 2
• alanine--glyoxylate aminotransferase 2
• Beta-ALAAT II
• Beta-alanine-pyruvate aminotransferase
• DAIBAT
• D-AIBAT
• EC 2.6.1.40
• EC 2.6.1.44
• mitochondrial

Background

AGXT2, also known as Alanin-glyoxylate aminotransferase 2, consists of a 524 amino acid isoform that is 57 kDa, and is involved in the conversion of glyoxylate to glycine, the digestion of asymmetric dimethylarginine, and the regulation of blood pressure. Current research is being conducted on AGXT2 and its relation to mycobacterium tuberculosis and primary hyperoxaluria. This protein is included in the pathways of nucleotide and pyrimidine metabolism where it interacts with AGXT, ALAS2, GATM, GCAT, and GLDC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AGXT2 Antibody (NBP1-89199)(1)

Publication using NBP1-89199

• Kittel A, Muller F, Konig J et al. Alanine-glyoxylate aminotransferase 2 (AGXT2) Polymorphisms Have Considerable Impact on Methylarginine and beta-aminoisobutyrate Metabolism in Healthy Volunteers. PLoS One 2014-01-01 [PMID: 24586340] (ICC/IF, WB)

Bioinformatics

• Gene Symbol: AGXT2
• Entrez:
  • 64902(Human)
• Uniprot:
  • Q9BYV1(Human)