AGXT2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AGXT2 Antibody [NBP1-89199] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: AGXT2 Antibody [NBP1-89199] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGXT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGXT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AGXT2 Protein (NBP1-89199PEP)
Publications
Read Publication using NBP1-89199.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%). Reactivity reported in scientific literature (PMID: 24586340)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGXT2 Antibody

  • (R)-3-amino-2-methylpropionate--pyruvate transaminase
  • AGT 2
  • alanine-glyoxylate aminotransferase 2
  • alanine--glyoxylate aminotransferase 2
  • Beta-ALAAT II
  • Beta-alanine-pyruvate aminotransferase
  • DAIBAT
  • D-AIBAT
  • EC 2.6.1.40
  • EC 2.6.1.44
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
46420002
Species: Hu
Applications: WB, ELISA
H00157724-R01
Species: Hu
NBP2-54724
Species: Hu
Applications: WB, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051733-M09
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AGXT2 Antibody (NBP1-89199)(1)

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for AGXT2 Antibody (NBP1-89199) (0)

There are no reviews for AGXT2 Antibody (NBP1-89199). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AGXT2 Antibody (NBP1-89199) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGXT2 Products

Bioinformatics Tool for AGXT2 Antibody (NBP1-89199)

Discover related pathways, diseases and genes to AGXT2 Antibody (NBP1-89199). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGXT2 Antibody (NBP1-89199)

Discover more about diseases related to AGXT2 Antibody (NBP1-89199).
 

Pathways for AGXT2 Antibody (NBP1-89199)

View related products by pathway.

PTMs for AGXT2 Antibody (NBP1-89199)

Learn more about PTMs related to AGXT2 Antibody (NBP1-89199).

Blogs on AGXT2

There are no specific blogs for AGXT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGXT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGXT2
Entrez
Uniprot