Recombinant Human AGPAT6 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, AP

Recombinant Human AGPAT6 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 39-137 of Human AGPAT6
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: SFGIRKLYMKSLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSA

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: AGPAT6
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AGPAT6 GST (N-Term) Protein

• 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acidacyltransferase, zeta)
• Acyl-CoA:glycerol-3-phosphate acyltransferase 4
• DKFZp586M1819,1-acyl-sn-glycerol-3-phosphate acyltransferase zeta
• EC 2.3.1.15
• glycerol-3-phosphate acyltransferase 4,1-AGP acyltransferase 6
• glycerol-3-phosphate acyltransferase 6,1-AGPAT 6
• GPAT4,1-acylglycerol-3-phosphate O-acyltransferase 6
• LPAAT-zetaLPAATZ
• Lysophosphatidic acid acyltransferase zeta
• testis spermatogenesis apoptosis-related protein 7
• TSARG7

Background

Glycerol-3-phosphate acyltransferase 4 (GPAT4), also known as AGPAT6, is a novel glycerolipid acyltransferase of the ER, which is crucial for the production of milk fat by the mammary gland.

Agpat6 deficiency leads to a reduction in body weight and resistance to both diet-induced and genetically induced obesity. This reduced body weight is associated with increased energy expenditure, reduced triglyceride accumulation in BAT and WAT, reduced white adipocyte size, and lack of adipose tissue in the subdermal region. AGPAT6 fills a unique role in determining triglyceride content and composition in adipose tissue and liver that cannot be compensated by other members of the Agpat family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGPAT6