Agpat4 Antibody - BSA Free

Western Blot: Agpat4 Antibody [NBP1-79870] - MCF7 Cell Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Agpat4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human AGPAT4The immunogen for this antibody is AGPAT4 (NP_064518). Peptide Sequence: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGPAT4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Agpat4 Antibody - BSA Free

• 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acidacyltransferase, delta)
• 1-AGP acyltransferase 4,1-acylglycerol-3-phosphate O-acyltransferase 4,1-AGPAT 4
• dJ473J16.2,1-acyl-sn-glycerol-3-phosphate acyltransferase delta
• EC 2.3.1.51
• LPAAT-delta1-AGPAT4
• Lysophosphatidic acid acyltransferase delta
• lysophosphatidic acid acyltransferase-delta (LPAAT-delta)

Background

Agpat4 encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Agpat4 Antibody (NBP1-79870)(1)

Publication using NBP1-79870

• Elena Silva, Véronique Ferchaud‐Roucher, Anita Kramer, Lana Madi, Priyadarshini Pantham, Stephanie Chassen, Thomas Jansson, Theresa L. Powell Oleic acid stimulation of amino acid uptake in primary human trophoblast cells is mediated by phosphatidic acid and mTOR signaling FASEB BioAdvances 2023-11-14 [PMID: 38223199]

Bioinformatics

• Gene Symbol: AGPAT4
• Entrez:
  • 56895(Human)
• Uniprot:
  • Q9NRZ5(Human)