Ago2/eIF2C2 Recombinant Protein Antigen

Images

 
There are currently no images for Ago2/eIF2C2 Recombinant Protein Antigen (NBP2-58382PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ago2/eIF2C2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ago2/eIF2C2.

Source: E. coli

Amino Acid Sequence: IQGYAFKPPPRPDFGTSGRTIKLQANFFEMDI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AGO2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58382.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ago2/eIF2C2 Recombinant Protein Antigen

  • AGO2argonaute 2
  • argonaute2
  • EC 3.1.26.n1
  • EC 3.1.26.n2
  • eIF2C 2
  • eIF-2C 2
  • Eukaryotic translation initiation factor 2C 2
  • eukaryotic translation initiation factor 2C, 2
  • hAgo2
  • MGC3183
  • PAZ Piwi domain protein
  • PPD
  • protein argonaute-2
  • Protein slicer
  • Q10

Background

Ago2 / eIF2C2 encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

202-IL
Species: Hu
Applications: BA
H00003930-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-71691
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NBP1-88223
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-86665
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-59631
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00002770-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
M5000
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP1-20194
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-87382
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-20428
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for Ago2/eIF2C2 Recombinant Protein Antigen (NBP2-58382PEP) (0)

There are no publications for Ago2/eIF2C2 Recombinant Protein Antigen (NBP2-58382PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ago2/eIF2C2 Recombinant Protein Antigen (NBP2-58382PEP) (0)

There are no reviews for Ago2/eIF2C2 Recombinant Protein Antigen (NBP2-58382PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ago2/eIF2C2 Recombinant Protein Antigen (NBP2-58382PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ago2/eIF2C2 Products

Research Areas for Ago2/eIF2C2 Recombinant Protein Antigen (NBP2-58382PEP)

Find related products by research area.

Blogs on Ago2/eIF2C2.

Ago2 antibodies and dicer-independent biogenesis of miRNA
Ago2, also called eIF2C2, antibody is one of 37 reagents targeted to the Argonaute protein family that we at Novus Biologicals have in our antibody catalogue. Argonaute proteins are encoded by genes which play an important role in regulating the contr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ago2/eIF2C2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AGO2