Recombinant Human Ago2/eIF2C2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Ago2/eIF2C2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 381-480 of Human EIF2C2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF2C2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ago2/eIF2C2 Protein

  • AGO2argonaute 2
  • argonaute2
  • EC 3.1.26.n1
  • EC 3.1.26.n2
  • eIF2C 2
  • eIF-2C 2
  • Eukaryotic translation initiation factor 2C 2
  • eukaryotic translation initiation factor 2C, 2
  • hAgo2
  • MGC3183
  • PAZ Piwi domain protein
  • PPD
  • protein argonaute-2
  • Protein slicer
  • Q10

Background

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-52926
Species: Hu
Applications: WB
NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-58069
Species: Hu
Applications: ICC/IF
NBP2-20428
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01) (0)

There are no publications for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01) (0)

There are no reviews for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ago2/eIF2C2 Products

Bioinformatics Tool for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01)

Discover related pathways, diseases and genes to Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01)

Discover more about diseases related to Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01).
 

Pathways for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01)

View related products by pathway.

PTMs for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01)

Learn more about PTMs related to Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01).
 

Research Areas for Ago2/eIF2C2 Partial Recombinant Protein (H00027161-Q01)

Find related products by research area.

Blogs on Ago2/eIF2C2.

Ago2 antibodies and dicer-independent biogenesis of miRNA
Ago2, also called eIF2C2, antibody is one of 37 reagents targeted to the Argonaute protein family that we at Novus Biologicals have in our antibody catalogue. Argonaute proteins are encoded by genes which play an important role in regulating the contr...  Read full blog post.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ago2/eIF2C2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2C2