AG-2/AGR2 Antibody (1C3)

Images

 
Western Blot: AG-2 Antibody (1C3) [H00010551-M03] - Analysis of AGR2 expression in MCF-7 (Cat # L046V1).
Western Blot: AG-2 Antibody (1C3) [H00010551-M03] - Analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M03), clone 1C3. Lane 1: AGR2 transfected lysatE (20 KDa). Lane 2: ...read more
ELISA: AG-2 Antibody (1C3) [H00010551-M03] - Detection limit for recombinant GST tagged AGR2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
1C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AG-2/AGR2 Antibody (1C3) Summary

Immunogen
AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Specificity
AGR2 - anterior gradient 2 homolog (Xenopus laevis)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AGR2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using
H00010551-M03 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AG-2/AGR2 Antibody (1C3)

  • AG2
  • AG-2
  • AG2member 17
  • AGR2
  • anterior gradient 2 homolog (Xenopus laevis)
  • anterior gradient homolog 2 (Xenopus laevis)
  • GOB-4
  • hAG-2
  • HPC8
  • PDIA17
  • secreted cement gland homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-15307
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-93457
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-04686
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-67309
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P

Publications for AG-2/AGR2 Antibody (H00010551-M03)(12)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 10 of 12. Show All 12 Publications.
Publications using H00010551-M03 Applications Species
Sommerova L, Ondrouskova E, Vojtesek B, Hrstka R et al. Suppression of AGR2 in a TGF-B-induced Smad regulatory pathway mediates epithelial-mesenchymal transition. BMC Cancer 2017 Aug 15 [PMID: 28810836]
Prochazkova I, Lenco J, Fucikova A et al. Targeted proteomics driven verification of biomarker candidates associated with breast cancer aggressiveness. Biochim Biophys Acta 2017 Feb 16 [PMID: 28216224]
Ahmad R, Nicora CD, Shukla AK et al. An efficient method for native protein purification in the selected range from prostate cancer tissue digests. Chin Clin Oncol 2016 Dec 2 [PMID: 28061542]
Dong A, Wodziak D, Lowe AW. EGFR Signaling Requires a Specific Endoplasmic Reticulum Thioredoxin for the Post-Translational Control of Receptor Presentation to the Cell Surface. J Biol Chem. 2015 Feb 09 [PMID: 25666625]
Riener MO, Thiesler T, Hellerbrand C et al. Loss of Anterior Gradient-2 expression is an independent prognostic factor in colorectal carcinomas. Eur J Cancer. 2014 Apr 30 [PMID: 24794000]
Gray TA, Murray E, Nowicki MW et al. Development of a fluorescent monoclonal antibody-based assay to measure the allosteric effects of synthetic peptides on self-oligomerization of AGR2 protein. Protein Sci. 2013 Jun 18 [PMID: 23780840]
Darb-Esfahani S, Fritzsche F, Kristiansen G et al. Anterior gradient protein 2 (AGR2) is an independent prognostic factor in ovarian high-grade serous carcinoma. Virchows Arch. 2012 Jul 03 [PMID: 22752467]
Wayner EA, Quek SI, Ahmad R, Ho ME, Loprieno MA, Zhou Y, Ellis WJ, True LD, Liu AY. Development of an ELISA to detect the secreted prostate cancer biomarker AGR2 in voided urine. Prostate. 2011 Nov 9. [PMID: 22072305] (ELISA, Human) ELISA Human
Lepreux S, Bioulac-Sage P, Chevet E. Differential expression of the anterior gradient protein-2 is a conserved feature during morphogenesis and carcinogenesis of the biliary tree. Liver Int. 2011 Jan 21 [PMID: 21281432]
Maslon MM, Hrstka R, Vojtesek B, Hupp TR. A divergent substrate-binding loop within the pro-oncogenic protein anterior gradient-2 forms a docking site for Reptin. J Mol Biol 404(3):418-38. 2010 Dec 3. [PMID: 20888340]
Show All 12 Publications.

Reviews for AG-2/AGR2 Antibody (H00010551-M03) (0)

There are no reviews for AG-2/AGR2 Antibody (H00010551-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AG-2/AGR2 Antibody (H00010551-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AG-2/AGR2 Products

Bioinformatics Tool for AG-2/AGR2 Antibody (H00010551-M03)

Discover related pathways, diseases and genes to AG-2/AGR2 Antibody (H00010551-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AG-2/AGR2 Antibody (H00010551-M03)

Discover more about diseases related to AG-2/AGR2 Antibody (H00010551-M03).
 

Pathways for AG-2/AGR2 Antibody (H00010551-M03)

View related products by pathway.

PTMs for AG-2/AGR2 Antibody (H00010551-M03)

Learn more about PTMs related to AG-2/AGR2 Antibody (H00010551-M03).
 

Research Areas for AG-2/AGR2 Antibody (H00010551-M03)

Find related products by research area.

Blogs on AG-2/AGR2

There are no specific blogs for AG-2/AGR2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AG-2/AGR2 Antibody (1C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol AGR2
Entrez
OMIM
Uniprot