AFF4 Antibody - BSA Free

Immunohistochemistry-Paraffin: AFF4 Antibody [NBP1-89220] - Staining of human hippocampus shows strong nuclear positivity in glial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AFF4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AFF4 Antibody - BSA Free (NBP1-89220) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-AFF4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKS
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AFF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AFF4 Protein (NBP1-89220PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25252976).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AFF4 Antibody - BSA Free

• AF4/FMR2 family, member 4
• AF5Q31AF4/FMR2 family member 4
• ALL1-fused gene from chromosome 5q31 protein
• Major CDK9 elongation factor-associated protein
• MCEFALL1 fused gene from 5q31
• MGC75036
• Protein AF-5q31

Background

AFF4, or AF4/FMR2 family member 4, contains a 127 kDa, 98 kDa, and 39 kDa isoform, and is involved in the process of improving the catalytic rate of RNA polymerase II transcription. Disease research is currently being conducted with AFF4 on its relation to acute lymphoblastic leukemia, as well as other types of leukemia. This protein interacts with SIAH1, CCNT1, MLLT3, MLLT1, and MED10 during the regulation of DNA-dependent transcription and the transcription of RNA polymerase II.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AFF4 Antibody (NBP1-89220)(1)

Publication using NBP1-89220

• Timothy J. Stasevich, Yoko Hayashi-Takanaka, Yuko Sato et al. Regulation of RNA polymerase II activation by histone acetylation in single living cells. Nature 2014-09-21 [PMID: 25252976] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: AFF4
• Entrez:
  • 27125(Human)
• Uniprot:
  • Q9UHB7(Human)