AFF2 Antibody

Western Blot: AFF2 Antibody [NBP2-84403] - Host: Rabbit. Target Name: AFF2. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

Western Blot: AFF2 Antibody [NBP2-84403] - WB Suggested Anti-AFF2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: OVCAR-3 cell lysateAFF2 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

Western Blot: AFF2 Antibody [NBP2-84403] - Host: Rabbit. Target Name: AFF2. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

AFF2 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human AFF2. Peptide sequence: MDLFDFFRDWDLEQQCHYEQDRSALKKREWERRNQEVQQEDDLFSSGFDL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AFF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AFF2 Antibody

• AF4/FMR2 family member 2
• AF4/FMR2 family, member 2
• FMR2fragile X mental retardation 2
• FMR2P
• Fragile X E mental retardation syndrome protein
• Fragile X mental retardation 2 protein
• FRAXEMRX2
• OX19
• Protein FMR-2
• Protein Ox19

Background

The AFF2 gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene isassociated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locusresults in silencing of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AFF2