AFF2 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human AFF2. Peptide sequence: MDLFDFFRDWDLEQQCHYEQDRSALKKREWERRNQEVQQEDDLFSSGFDL The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
AFF2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for AFF2 Antibody
Background
The AFF2 gene encodes a putative transcriptional activator that is a member of the AF4\FMR2 gene family. This gene isassociated with the folate-sensitive fragile X E locus on chromosome X. A repeat polymorphism in the fragile X E locusresults in silencing of
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC
Species: Hu, Mu
Applications: IHC, WB
Species: Mu
Applications: Block, WB
Publications for AFF2 Antibody (NBP2-84403) (0)
There are no publications for AFF2 Antibody (NBP2-84403).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AFF2 Antibody (NBP2-84403) (0)
There are no reviews for AFF2 Antibody (NBP2-84403).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AFF2 Antibody (NBP2-84403) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AFF2 Products
Bioinformatics Tool for AFF2 Antibody (NBP2-84403)
Discover related pathways, diseases and genes to AFF2 Antibody (NBP2-84403). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for AFF2 Antibody (NBP2-84403)
Discover more about diseases related to AFF2 Antibody (NBP2-84403).
| | Pathways for AFF2 Antibody (NBP2-84403)
View related products by pathway.
|
PTMs for AFF2 Antibody (NBP2-84403)
Learn more about PTMs related to AFF2 Antibody (NBP2-84403).
|
Blogs on AFF2