AF9 Antibody (1T4V6)

Western Blot: AF9 Antibody (1T4V6) [NBP3-33324] - Western blot analysis of various lysates using AF9 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1T4V6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

AF9 Antibody (1T4V6) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human AF9 (NP_004520.2).
  
  Sequence:
  MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MLLT3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AF9 Antibody (1T4V6)

• AF-9
• AF9myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 3
• ALL1-fused gene from chromosome 9 protein
• myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 3
• myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 3
• Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein
• protein AF-9
• YEATS domain-containing protein 3
• YEATS3FLJ2035

Background

The human AF9 gene is one of the most common fusion partner genes with the ALL1 gene at 11q23 (also called MLL), resulting in the t(9;11)(p22;q23) fusion. The AF9 gene is more than 100 kb, and 2 patient breakpoint cluster regions (BCRs) have been identified. BCR1 is found within intron 4, previously called site A, whereas BCR2 or site B spans introns 7 and 8.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MLLT3