Recombinant Human AF4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AF4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 71 - 170 of Human AFF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG

Protein/Peptide Type
Partial Recombinant Protein
Gene
AFF1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AF4 Protein

  • AF-4
  • AF4/FMR2 family member 1
  • AF4/FMR2 family, member 1
  • AF4myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 2
  • ALL1-fused gene from chromosome 4 protein
  • FEL
  • MLLT2MGC134969
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 2
  • PBM1
  • pre-B-cell monocytic leukemia partner 1
  • Protein AF-4
  • Protein FEL
  • Proto-oncogene AF4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NB100-1566
Species: Hu
Applications: WB, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-87714
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81872
Species: Hu
Applications: IHC, IHC-P
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-49154
Species: Hu
Applications: IHC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027125-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
H00004299-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for AF4 Partial Recombinant Protein (H00004299-Q01) (0)

There are no publications for AF4 Partial Recombinant Protein (H00004299-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AF4 Partial Recombinant Protein (H00004299-Q01) (0)

There are no reviews for AF4 Partial Recombinant Protein (H00004299-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AF4 Partial Recombinant Protein (H00004299-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AF4 Products

Bioinformatics Tool for AF4 Partial Recombinant Protein (H00004299-Q01)

Discover related pathways, diseases and genes to AF4 Partial Recombinant Protein (H00004299-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AF4 Partial Recombinant Protein (H00004299-Q01)

Discover more about diseases related to AF4 Partial Recombinant Protein (H00004299-Q01).
 

Pathways for AF4 Partial Recombinant Protein (H00004299-Q01)

View related products by pathway.

PTMs for AF4 Partial Recombinant Protein (H00004299-Q01)

Learn more about PTMs related to AF4 Partial Recombinant Protein (H00004299-Q01).

Blogs on AF4

There are no specific blogs for AF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AF4 Antibody
NBP1-28728

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AF4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AFF1