AF10 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AF10 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AF10
  
  

  Source: E.coli

  Amino Acid Sequence: IVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPSM

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MLLT10
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25268It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AF10 Recombinant Protein Antigen

• AF10MGC75086
• ALL1-fused gene from chromosome 10 protein
• DKFZp686E10210
• myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 10
• myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 10
• protein AF-10
• type I AF10 protein

Background

AF10 is a putative transcription factor containing a leucine zipper motif. A t(10;11)(p12;q23) chromosomal translocation present in a proportion of acute myeloid leukaemias results in expression of an AF10 (carboxy terminus) MLL (amino terminus) fusion protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MLLT10