Adropin Antibody

Images

 
Immunohistochemistry-Paraffin: Adropin Antibody [NBP1-88245] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Adropin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENHO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Adropin Protein (NBP1-88245PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Adropin Antibody

  • Adropin
  • C9orf165
  • chromosome 9 open reading frame 165
  • energy homeostasis associated
  • Energy homeostasis-associated protein
  • ENHO
  • GAAI470
  • UNQ470

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1360
Species: Mu
Applications: WB, IHC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for Adropin Antibody (NBP1-88245) (0)

There are no publications for Adropin Antibody (NBP1-88245).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adropin Antibody (NBP1-88245) (0)

There are no reviews for Adropin Antibody (NBP1-88245). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Adropin Antibody (NBP1-88245) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adropin Products

Bioinformatics Tool for Adropin Antibody (NBP1-88245)

Discover related pathways, diseases and genes to Adropin Antibody (NBP1-88245). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adropin Antibody (NBP1-88245)

Discover more about diseases related to Adropin Antibody (NBP1-88245).
 

Pathways for Adropin Antibody (NBP1-88245)

View related products by pathway.

PTMs for Adropin Antibody (NBP1-88245)

Learn more about PTMs related to Adropin Antibody (NBP1-88245).
 

Research Areas for Adropin Antibody (NBP1-88245)

Find related products by research area.

Blogs on Adropin

There are no specific blogs for Adropin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adropin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENHO
Entrez
Uniprot