ADRM1 Antibody - BSA Free

Western Blot: ADRM1 Antibody [NBP1-88993] - Analysis in control (vector only transfected HEK293T lysate) and ADRM1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: ADRM1 Antibody [NBP1-88993] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: ADRM1 Antibody [NBP1-88993] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADRM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADRM1 Antibody - BSA Free (NBP1-88993) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQ
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADRM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ADRM1 Protein (NBP1-88993PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADRM1 Antibody - BSA Free

• 000 surface antigen
• 110 kDa cell membrane glycoprotein
• adhesion regulating molecule 1
• Adhesion-regulating molecule 1
• ADRM1
• ARM1
• ARM-1
• Gp110
• GP110hRpn13
• M(r) 110
• MGC29536
• proteasomal ubiquitin receptor ADRM1
• Proteasome regulatory particle non-ATPase 13
• PSMD16
• regulatory particle non-ATPase 13
• Rpn13 homolog
• Rpn13

Background

ADRM1 is encoded by this gene is an integral plasma membrane protein which promotes cell adhesion. The encoded protein is thought to undergo O-linked glycosylation. Expression of this gene has been shown to be induced by gamma interferon in some cancer cells. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADRM1
• Entrez:
  • 11047(Human)
• Uniprot:
  • Q16186(Human)