ADRM1 Antibody

Images

 
Western Blot: ADRM1 Antibody [NBP1-88993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ADRM1 Antibody [NBP1-88993] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ADRM1 Antibody [NBP1-88993] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADRM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADRM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ADRM1 Protein (NBP1-88993PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADRM1 Antibody

  • 000 surface antigen
  • 110 kDa cell membrane glycoprotein
  • adhesion regulating molecule 1
  • Adhesion-regulating molecule 1
  • ARM1
  • ARM-1
  • Gp110
  • GP110hRpn13
  • M(r) 110
  • MGC29536
  • proteasomal ubiquitin receptor ADRM1
  • Proteasome regulatory particle non-ATPase 13
  • regulatory particle non-ATPase 13
  • Rpn13 homolog
  • Rpn13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57955
Species: Hu
Applications: WB, ICC/IF
AF5540
Species: Mu
Applications: WB
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-80835
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01294
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF8408
Species: Hu
Applications: WB
NBP1-78758
Species: Hu
Applications: WB (-), IP
NBP1-89909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32510
Species: Hu
Applications: WB
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
H00001072-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
H00029978-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ADRM1 Antibody (NBP1-88993) (0)

There are no publications for ADRM1 Antibody (NBP1-88993).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADRM1 Antibody (NBP1-88993) (0)

There are no reviews for ADRM1 Antibody (NBP1-88993). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADRM1 Antibody (NBP1-88993) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADRM1 Products

Bioinformatics Tool for ADRM1 Antibody (NBP1-88993)

Discover related pathways, diseases and genes to ADRM1 Antibody (NBP1-88993). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADRM1 Antibody (NBP1-88993)

Discover more about diseases related to ADRM1 Antibody (NBP1-88993).
 

Pathways for ADRM1 Antibody (NBP1-88993)

View related products by pathway.

PTMs for ADRM1 Antibody (NBP1-88993)

Learn more about PTMs related to ADRM1 Antibody (NBP1-88993).

Blogs on ADRM1

There are no specific blogs for ADRM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADRM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADRM1
Entrez
Uniprot