Adrenomedullin R/ADMR/GPR182 Antibody (3B10) - Azide and BSA Free

Sandwich ELISA: Adrenomedullin R/ADMR/GPR182 Antibody (3B10) [H00011318-M04] - Detection limit for recombinant GST tagged GPR182 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Adrenomedullin R/ADMR/GPR182 Antibody (3B10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Adrenomedullin R/ADMR/GPR182 Antibody (3B10) - Azide and BSA Free (H00011318-M04) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: GPR182 (NP_009195, 1 a.a. ~ 54 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRV
• Specificity: Reacts with G protein-coupled receptor 182.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GPR182
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Sandwich ELISA
  • Western Blot 1:100-1:2000
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Adrenomedullin R/ADMR/GPR182 Antibody (3B10) - Azide and BSA Free

• 7TMR
• ADMR
• Adrenomedullin R
• adrenomedullin receptor
• AdrenomedullinR
• AMR
• AM-R
• G protein-coupled receptor 182,7TMR
• G10D
• GAMRH
• Gpcr22
• GPR182
• G-protein coupled receptor 182
• hrhAMR
• MB10
• MGC34399
• NOW

Background

Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR182
• Entrez:
  • 11318(Human)
• Uniprot:
  • NP_009195()