Independent Antibodies: Staining of human duodenum, small intestine, stomach and testis using NBP1-90361 (A) shows similar protein distribution across tissues to independent antibody NBP1-87404 (B).
Orthogonal Strategies: Analysis in human duodenum and testis tissues using NBP1-90361 antibody. Corresponding ADA RNA-seq data are presented for the same tissues.
Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.
Staining of human testis shows weak cytoplasmic positivity in cells in Leydig cells.
Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells.
Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
This antibody was developed against Recombinant Protein corresponding to amino acids: QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in ICC/IF reported in scientific literature (PMID:34445661). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation permeabilization: PFA/Triton X-100.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (88%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Adenosine Deaminase/ADA Antibody - BSA Free
ADA
ADA1
adenine deaminase
Adenosine aminohydrolase
Adenosine Deaminase
EC 3.5.4.4
Background
Adenosine deaminase is an enzyme involved in purine metabolism. It is needed for the breakdown of adenosine from food and from the turnover of nucleic acids in tissues. It irreversibly deaminates adenosine, converting it to the related nucleoside inosine by the removal of an amine group. Inosine can then be deribosylated (removed from ribose) by another enzyme called purine nucleoside phosphorylase (PNP), converting it to hypoxanthine. Mutations in the gene for adenosine deaminase causing it to not be expressed are one cause of severe combined immunodeficiency (SCID). Mutations causing it to be overexpressed are one cause of hemolytic anemia. There is some evidence that a different allelle (ADA2) may lead to autism. There are 2 isoforms of ADA: ADA1 and ADA2. ADA1 is found in most body cells, particularly lymphocytes and macrophages, where it is present not only in the cytosol but also as the ecto- form on the cell membrane attached to a protein called CD26. ADA2 has only been found in the macrophage where it co-exists with ADA1 where the two isoforms regulate the ratio of adenosine to deoxyadenosine to potentiate the killing of parasites. ADA2 is the predominant form present in human plasma and is increased in many diseases, particularly those associated with the immune system: for example rheumatoid arthritis, psoriasis and sarcoidosis. The plasma AD2 isoform is also increased in most cancers.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Adenosine Deaminase/ADA Antibody (NBP1-90361) (0)
There are no reviews for Adenosine Deaminase/ADA Antibody (NBP1-90361).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Adenosine Deaminase/ADA Antibody (NBP1-90361). (Showing 1 - 1 of 1 FAQ).
On your web-page there is a western blot analysis of different cell lines with expressed ADA (if I understand correctly). Why there are two arrowheads for ADA, what is in the second band detected by your antibody?
ADA seems to run at many different sizes. Our Application Notes for another ADA antibody states: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. In some tissues ADA1 also exists as a monomer and a dimer form, whereas, and the isoform ADA2 only exists as a monomer. So we cannot say exactly what the band is but we know it is a different size due to post translational modification.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Adenosine Deaminase/ADA Antibody - BSA Free and receive a gift card or discount.